KEGG   Hymenobacter sp. 17J68-5: FHG12_01700Help
Entry
FHG12_01700       CDS       T06049                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hyj  Hymenobacter sp. 17J68-5
Pathway
hyj00860  Porphyrin and chlorophyll metabolism
hyj01100  Metabolic pathways
hyj01110  Biosynthesis of secondary metabolites
hyj01120  Microbial metabolism in diverse environments
Module
hyj_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:hyj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FHG12_01700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hyj01007]
    FHG12_01700
Enzymes [BR:hyj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     FHG12_01700
Amino acid related enzymes [BR:hyj01007]
 Aminotransferase (transaminase)
  Class III
   FHG12_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QDA58890
UniProt: A0A5B7ZV77
Position
complement(458593..459963)
Genome map
AA seq 456 aa AA seqDB search
MSASSLSESSAAGIAAESGTTRAFTQSQALQARFHAAIPGGSHTYAKGDDQFPEFMPPYL
VRGQGCRVWDVDGNEYVEYGMGLRSVTLGHAYAPVVQAAQKAMLDGVNLGRPTVLELEAA
EDFLRTVQAGEMVKFAKNGSDVTTAAIKLARAATGRDLIAICADHPFFSTDDWFMGSTPV
RAGVPNAVRELTLSFRYNDLSSVEALFLQHPRQIAALILEVEKDVPPVPGFLAGLRQLCD
REGTVLIFDEIITGLRWHVGGAQAVHGVRPDLSTFGKALGNGFSIAALTGRRDLMELGGL
LHDRERVFLLSTTYGAESHALAAMQAVLETYRREPVIAHMYEQGERLRLGLEQAARDQQV
EDYFRVFGPACSLVYGTRDAEGKPSQPFRTLFLQETLRRGLLLPSLIISYAHKPADVDLT
VERIHEALGVYRRALTDGVEVYLEGRPVKPVYRTHN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttcttctttatctgagtcttctgctgctggtatagcggccgaatccggtact
actcgtgctttcacccagtcgcaggcgttgcaggcgcgctttcacgcggccattcccggc
ggcagccatacctatgccaaaggcgatgaccagtttccggagtttatgccaccttatctg
gtgcgggggcaaggctgccgggtatgggatgttgatggaaatgagtacgttgagtacggc
atgggcctgcgctccgtaaccttggggcatgcctatgcaccagtagtacaagctgcgcaa
aaagcgatgctcgacggcgttaatctgggccgcccgacggtcctcgagttagaagccgcc
gaggatttcctgcgcacggtgcaggctggtgagatggtgaagtttgcgaaaaacggctcc
gatgttacgacggccgccatcaaactggcgcgggccgctacgggccgtgatcttattgcc
atctgtgccgatcatccatttttctctaccgacgactggtttatggggagcaccccggtg
cgggccggggtgcccaatgccgtgcgcgaactcaccctatccttccgctacaacgacttg
agcagcgtcgaggcgctgtttttgcaacatccccggcagatagcggccttgatattggaa
gttgaaaaagacgtgccgcccgtgccgggctttctggccggcttacgacagctctgcgac
cgcgaaggcacggtgctgatttttgacgaaatcatcactgggttgcgctggcacgtaggc
ggcgcacaggccgtacacggcgttcggcccgacttgagcacgtttggaaaagcactgggg
aacgggttcagcattgcggctctcactggacgccgcgacctgatggaactcggtggattg
ctccacgatcgtgagcgagtgttcttactgtcaactacttacggcgccgaatcgcatgcc
ttggctgccatgcaggccgtactcgaaacctaccggcgcgaacccgttatcgcgcacatg
tatgagcaaggcgaacggctgcgactgggtctcgaacaggccgcccgcgaccagcaggta
gaagattattttcgggtatttgggccagcctgcagcttggtatacggaacgcgcgacgca
gaaggcaagccttctcagcccttccggacgctgttcttacaggaaaccctgcgccgtggc
ttgctgctaccgtcgcttatcatcagctacgcgcacaagcccgccgacgttgatctgacg
gttgagcgcattcacgaggcgctgggggtttaccgccgggctctcaccgacggggttgag
gtatatctggaagggcggccagtgaagccggtttaccggactcataactag

DBGET integrated database retrieval system