KEGG   Hymenobacter sp. 17J68-5: FHG12_02225Help
Entry
FHG12_02225       CDS       T06049                                 

Definition
(GenBank) HAD family phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
hyj  Hymenobacter sp. 17J68-5
Pathway
hyj00010  Glycolysis / Gluconeogenesis
hyj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hyj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FHG12_02225
Enzymes [BR:hyj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     FHG12_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like EF-hand_6
Motif
Other DBs
NCBI-ProteinID: QDA58990
UniProt: A0A5B7ZVH4
Position
604402..605064
Genome map
AA seq 220 aa AA seqDB search
MTLLRRLPNLLFDFGGVIININYQLTLEAMRQFSAAGSTIEFNQQHQSDLFDRMETGRLS
PAEFRDGLRQGYELTGTDEELDAAWNAMLLDVPADRLALIAELRAQGHQTALLSNTNRIH
IEEINRRLATTYGFEHGIADALDRVFYSQEVGLRKPGDDIFHHALREMNWKPEETLFIED
SFQHIETARRLGLQTLHLAPPLTLTEALPAAIRAFTPATA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcttcgccgtttgcccaacctgctttttgacttcggaggcgttattatcaac
atcaattatcagctcaccttggaggctatgcggcaatttagtgcggcgggcagcaccatc
gaattcaaccagcagcaccagtccgatttgtttgatcgcatggaaaccggacggctttcc
ccggctgaatttcgcgatggcttgcgccaaggctacgagctgacgggcaccgacgaagag
cttgatgcggcctggaacgccatgctgctcgacgtgcccgccgaccgcctggccctgatt
gccgagctgcgcgcccaaggccaccaaacggcgctgctctccaacaccaatcgcattcat
attgaggagattaaccgtcgactagccaccacgtacgggtttgagcacggcattgctgat
gcgctcgatcgcgttttttattcgcaggaagtaggcttgcgcaagcccggcgacgacatt
ttccaccacgccctgcgcgaaatgaactggaagccggaagaaactcttttcatcgaagac
agttttcaacacatcgaaactgcgcggcgcctgggcttgcagaccttgcacttggcgccg
ccgctcacgcttaccgaagcccttcctgccgccatccgtgccttcactcctgccactgcc
tga

DBGET integrated database retrieval system