KEGG   Hymenobacter sp. 17J68-5: FHG12_14685Help
Entry
FHG12_14685       CDS       T06049                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hyj  Hymenobacter sp. 17J68-5
Pathway
hyj00480  Glutathione metabolism
hyj00590  Arachidonic acid metabolism
hyj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FHG12_14685
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FHG12_14685
Enzymes [BR:hyj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FHG12_14685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: QDA61263
Position
3529211..3529804
Genome map
AA seq 197 aa AA seqDB search
MKASFTIVAATLALAGLSSYTFSQPVSSMIDSTTEAPAAQGTVYDYTVKTIDGKEVKLSQ
YKGKKLLIVNTASECGFTPQYKELEELYKKHGDKVVVLGFPANNFGGQEPGTNSQIATFC
EKNYGVSFPLFSKISVKGDDTDPLYKFLSDKGKNGVVSDAPTWNFCKYLIDEQGHVVKFY
PSKVKPMSDELLADILK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttcgtttacgattgtggcggcaacactggctttggccggattgtcgtcttac
acgttctctcaacccgtttcttccatgattgactcaaccaccgaagcgcctgctgcacag
ggcaccgtttacgattacaccgtcaaaaccatcgacggcaaagaagtgaaactgagccaa
tacaaaggcaaaaagctcctcatcgtcaatacggcgtcggagtgtggctttacgccgcag
tacaaggaactggaagaactgtataagaagcacggcgacaaagtggtcgtactgggtttt
ccggccaacaattttggcggccaagaacccggcaccaattcgcagattgccaccttctgc
gagaaaaactacggcgtcagctttcctctgttcagcaaaatttcggtgaaaggcgacgac
accgatccgctgtataagttcctgtcggacaaggggaagaacggagtcgtgagcgatgcg
cccacctggaacttctgcaaatacctcatcgatgagcaaggccacgtcgtgaagttttat
ccgtcgaaggtgaagcccatgagcgacgaactgctcgccgacattctgaaataa

DBGET integrated database retrieval system