KEGG   Hymenobacter sp. 17J68-5: FHG12_15125Help
Entry
FHG12_15125       CDS       T06049                                 

Gene name
ltaE
Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hyj  Hymenobacter sp. 17J68-5
Pathway
hyj00260  Glycine, serine and threonine metabolism
hyj01100  Metabolic pathways
hyj01110  Biosynthesis of secondary metabolites
hyj01120  Microbial metabolism in diverse environments
hyj01130  Biosynthesis of antibiotics
hyj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hyj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FHG12_15125 (ltaE)
Enzymes [BR:hyj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FHG12_15125 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: QDA61345
Position
complement(3640689..3641729)
Genome map
AA seq 346 aa AA seqDB search
MADPIIDLRSDTVTRPTPAMLEAMFNAPVGDDVYEEDPTVRALEETAAARFGLEAGLFCP
SGTMTNQIAIKAHTEPLSEVICEQTAHVYLWEVGGIAFHSGASVALLPGDRGLLTAAQVE
AAIRPANNVHYPDTRLVCLENTHNRGGGSCYSIETIAEIADVARRHNLKLHLDGARIFNA
LVATGQQAADYGRYFDSISVCLSKGLGTPVGSVLLGSKEFIRKCRRIRKVMGGGMRQAGY
LAAAGLYALEHNVERLADDHRRARQLASALADQPYVDFVLPAETNLVIFRLKDEMPADSF
LRHLEQQGIRASSFGPQMIRFVTHLDVDDAMVQRIEDALVALQPVA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctgacccaattatcgatttgcgctccgataccgtgacgcgccccactccggccatg
ctggaggccatgttcaacgccccggtcggcgacgatgtatacgaagaagacccaactgtg
cgcgccctggaagagaccgccgcggcccgctttgggctggaggccggcctgttctgcccg
tccggtaccatgaccaatcagattgcgattaaggctcacaccgagccgctatcggaagtt
atttgcgagcaaacggcccacgtttatttgtgggaagtcggcggcatagccttccactcg
ggggcttcggtggcgttgctccccggcgaccggggcctgctcacggccgcgcaggtagaa
gcagccatccggcccgctaacaacgtgcactaccccgacacgcgccttgtgtgcctcgaa
aatacgcacaaccggggcggcggcagctgctactcaatcgaaaccattgccgaaatcgcc
gacgtggcgcgccgtcacaacctgaagctgcacctcgacggtgcccgaatttttaatgcc
ttggtagctaccggtcagcaagccgccgactacggccgctacttcgactctatctcggtg
tgtttgtcgaaaggcttgggcacgccggtgggttcggtgctgctgggctcgaaggaattt
atccgtaaatgccgccgcatccgcaaagtgatggggggcggtatgcggcaggcgggttac
ctcgccgcggcgggcctgtacgccctagagcacaacgtggagcgcctcgccgacgaccat
cggcgcgcgcgtcagctggcctcagcgctggccgatcagccctatgtcgattttgtgctg
cctgccgaaacgaacctcgttattttccggctgaaagacgagatgcccgccgacagcttc
ctgcggcatctggagcagcaaggcattcgggcctcgtcgtttgggccgcaaatgatccgc
ttcgtaacgcacctcgacgttgatgatgccatggttcagcgcatcgaagatgcgctggtc
gccttgcagcctgtagcttag

DBGET integrated database retrieval system