KEGG   Hydrogenophaga sp. LPB0072: LPB072_03565Help
Entry
LPB072_03565      CDS       T04505                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00480  Glutathione metabolism
hyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LPB072_03565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyl02000]
    LPB072_03565
Enzymes [BR:hyl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LPB072_03565
Transporters [BR:hyl02000]
 Other transporters
  Pores ion channels [TC:1]
   LPB072_03565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AOW12065
UniProt: A0A162SVT4
Position
740848..741471
Genome map
AA seq 207 aa AA seqDB search
MKSSIQLYRNAISGHCHRVELLLSLLGLPFELIDVDLLNGEHKSPAFLALNPLGQVPVLC
DGELTLSDSNAMLVYLEGRYAPGRWLPRDPVGAARVQRWLSLAAGPLAYGAASARVVQLL
RLATEPKEAIDRATGLFELMEMELSRAPCLVGDQATLADLAHYAYVARAPEGLISLQPYP
AIRAWLARIEALPGFVPMVKTPVGLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctccattcagctgtaccgcaacgccatctccggtcactgtcaccgggttgag
ctcttgctctcactgctcggcctgccgtttgaattgatcgatgtcgatctgctgaacggc
gaacacaagtcgcccgcctttctggccctgaacccgctggggcaagtgcccgtgctgtgc
gacggggaactgacgctgagcgattccaatgccatgctcgtgtaccttgaggggcgctat
gcaccgggtcggtggctgccgcgcgaccctgtcggtgcagcacgtgtgcaacgctggctt
tctctggcggcagggccgctggcctatggtgccgcctcggcgcgtgttgtgcagttgttg
aggctggcgaccgaaccgaaggaagcgattgatcgcgccacgggcttgtttgaattgatg
gagatggaactgtcgcgggcgccctgtcttgtcggtgatcaggccacattggccgatctg
gcgcattacgcttatgtggcgcgcgcgccggagggactgatttcgctgcagccctatccg
gccatccgcgcctggctggcgcgcattgaggccctgcctggcttcgtgcccatggtcaag
acccccgtggggcttgcagaatga

DBGET integrated database retrieval system