KEGG   Hydrogenophaga sp. LPB0072: LPB072_03585Help
Entry
LPB072_03585      CDS       T04505                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00220  Arginine biosynthesis
hyl00330  Arginine and proline metabolism
hyl01100  Metabolic pathways
hyl01110  Biosynthesis of secondary metabolites
hyl01130  Biosynthesis of antibiotics
hyl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    LPB072_03585
   00330 Arginine and proline metabolism
    LPB072_03585
Enzymes [BR:hyl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LPB072_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AOW12069
UniProt: A0A167HDJ9
Position
complement(744045..744965)
Genome map
AA seq 306 aa AA seqDB search
MQKQTVQLIGVPTDIGAGARGASMGPEALRVAGLAAVLESHDLQVHDIGNLPGPANPWLP
PDQGYRHLKEVEQWNQTLHDAVHAALARDHLPMVLGGDHCLGIGSISAVARHCRETGKTL
RVLWLDAHADFNTAELTPSGNVHGMPVAVLCGHGPKELTGIGGTTPAISPSVVRQIGIRS
VDEGEKRFVHKHGLEVFDMRYIDEKGMRHTMEQALAGMDDNTHLHVSFDVDFLDPEIAPG
VGTTVPGGPTYREAQLCMEMIADTGRMASMDVMELNPALDVRNRTALVAVDLIESLFGKS
TLMRKG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacaaaccgttcaactgattggcgtgcccaccgatatcggcgcgggcgcgcgc
ggcgcctccatgggccccgaagcactgcgggtggcgggccttgctgcggtgctggaaagc
catgacctgcaggtgcacgacatcggcaacctgccaggccctgccaacccctggctaccg
cccgaccaaggctaccggcacctgaaagaggtcgaacaatggaaccagaccctgcacgat
gcagtgcacgcggcattggcccgggaccaccttcccatggtgctgggcggcgaccattgc
ctgggtataggctctatcagcgccgtggcgcgccattgcagagaaaccggaaaaaccctc
cgcgtgctctggctcgacgcccacgccgacttcaacacggccgaactcacccccagtggc
aacgtgcacggcatgcccgttgccgtgctgtgtggccacggcccaaaggaactcaccggc
atcggcggcaccaccccggcgatttcgccgtcggtcgttcgccagattggtatccgcagc
gttgacgaaggcgagaaacgcttcgtgcacaagcacggcctcgaggtgttcgacatgcgc
tacatcgacgaaaaaggcatgcgccacaccatggaacaggcactggccggtatggacgac
aacacccacctgcacgtgagtttcgacgtcgacttccttgacccggaaatcgcgccaggc
gtgggcaccaccgtgcccggtggccccacctaccgggaagcacagctgtgcatggaaatg
attgccgataccggccgcatggcatcgatggacgtgatggaactcaacccggccctcgac
gtgcgcaaccgcaccgcgctggtggcggtagacctcatcgaaagcctgttcggcaaatcc
acgctcatgagaaaggggtga

DBGET integrated database retrieval system