KEGG   Hydrogenophaga sp. LPB0072: LPB072_03610Help
Entry
LPB072_03610      CDS       T04505                                 

Definition
(GenBank) MBL fold metallo-hydrolase
Organism
hyl  Hydrogenophaga sp. LPB0072
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Rhodanese Lactamase_B_5 Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: AOW12073
UniProt: A0A162YXI2
Position
753236..754351
Genome map
AA seq 371 aa AA seqDB search
MKPIQLFDTASSTYTYVLFDQSTREALIIDPVDEQIERDLDALREYGLKLVWAVETHAHA
DHITSAGKLAELAGARTAAPVGCNIGTAGVQLKDGDTLQFGGETLKALHTPGHTAGSMSF
VWRDHVFTGDTLLINGCGRTDFQSGSASDLYRSLTQTLFTLPDATTVWPGHDYQGRTHSS
IGQEKTSNARVAGKSEAEFIAIMDALNLPRPKRIDEAVPANLTSGIRHDADGALLMQPRA
VDASYAGDVSPALAWQWFQSGEAAMVDVRSDAEREWVGYVPGALPLAWKQWPGMAMNPAF
DEGVRQAAANGKKLVLLCRSGVRSIAAAKRATELGLEAYNILEGFEGDPDADAHRGNKGG
WRHHGLPWRQN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgattcagctgtttgataccgcttccagcacctacacctatgtgttgtttgat
caatccacgcgtgaggcgttgatcatcgatccggtggacgaacaaatcgagcgcgatctg
gatgccttgcgcgaatatgggctcaaactggtgtgggcggtggaaacccatgcccacgcc
gaccacatcaccagcgcaggcaagcttgccgaactggcgggcgcccggacggcggctccc
gtgggctgcaacatcggcaccgccggcgttcagctcaaggacggcgacacgctgcaattt
ggtggtgaaaccctcaaagccctgcacacgccgggccataccgcgggcagcatgagtttt
gtctggcgcgaccatgtgttcaccggggacacgctgctcatcaacggttgtggtcgaacc
gacttccagtcgggcagtgccagtgacctgtaccgcagcctcacgcaaaccctgtttacc
ttgcccgacgcgaccaccgtgtggccgggccacgattaccagggccgcacgcactccagc
atcgggcaggaaaaaacctcaaacgcgcgggtggcgggcaaatccgaggccgagttcatc
gccatcatggacgcgctcaatctgcccaggcccaagcgcatagacgaagccgttcccgcc
aacctcacatcggggattcgccacgacgccgacggagccttgctgatgcagccgcgcgcc
gtggacgcgtcctatgcgggtgatgtgtcgcctgcactggcctggcaatggttccagtcg
ggcgaggccgcgatggttgatgtgcgctccgatgccgagcgcgaatgggtgggctacgta
cccggcgccctgccactggcgtggaagcagtggcccggcatggccatgaacccggcgttt
gatgagggcgtcaggcaggctgcggccaacggcaagaaactggttttgctgtgccgcagc
ggggtgcgatccattgccgcggccaagcgggccaccgaactgggacttgaggcttacaac
attctcgaaggatttgagggcgatcccgatgccgacgcccaccgaggcaacaagggcgga
tggcgtcaccatggcctgccctggcgccagaattga

DBGET integrated database retrieval system