KEGG   Hydrogenophaga sp. LPB0072: LPB072_03720Help
Entry
LPB072_03720      CDS       T04505                                 

Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00561  Glycerolipid metabolism
hyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LPB072_03720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyl04147]
    LPB072_03720
Enzymes [BR:hyl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LPB072_03720
Exosome [BR:hyl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPB072_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-ProteinID: AOW12089
UniProt: A0A167HDZ6
Position
complement(776427..777923)
Genome map
AA seq 498 aa AA seqDB search
MSDYLLALDQGTSSSRSIVFDRTGRVVAMAQQEFPQIYPQPGWVEHEPQALWTTQLATAR
QALKKAGLSASAIRAIGITNQRETTLVWNRKTGEPIHNAIVWQDRRAEATCVELRDRGLT
DTVLQKTGLRIDAYFSATKLAWLLDNVTGAREQAERGELAFGTVDSWLIWKLTGGAQHVT
DHSNAARTMLFNIHDQRWDGELLDALRIPASMMPKSLPSSADFGLTQAEWLGAPLTIGGV
AGDQQSALFGQACFSAGMAKNTYGTGCFMLMHTGERFQISENGLITTAAAQPPGRPQYAL
EGSVFIGGAVIQWLRDGLNAIQSSSEVQALAESVPDTGGVVLVPAFTGLGAPYWQPDTRG
SLTGLTRGTTVAHIARAALESIAFQSTALLAAMSRDAVSAGGVEVQELRVDGGACVNDLL
MQFQADLLGIPVVRPAVIETTALGAAYLAGLHTGLYQGLDELSAQWRAERTFEPQMAREE
AAEKMGRWEHAVRQTVAT
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactatttgctggccctggaccagggcacctccagttcccgcagcatcgttttt
gaccgcaccggccgcgtggtggccatggcgcagcaggagtttccccagatctacccccaa
cccgggtgggtcgaacacgagccccaggcgctttggaccacccagctcgctactgcgcgc
caggctttgaaaaaagccggtctgagcgcttcagccattcgcgccatcggcatcaccaac
cagcgcgaaaccacgctggtctggaaccggaaaacgggtgaacccattcacaacgccatc
gtctggcaagaccgccgggcggaagcgacctgcgtcgagctgcgtgaccgcggcctcacc
gataccgtgttgcagaaaaccggtttgcgcatcgacgcctacttttcggccaccaaactg
gcctggttgctggacaacgtgacaggcgcgcgcgagcaggccgagcgcggcgagctcgcc
ttcggcacggtcgacagctggttgatctggaaactcactggcggtgcccagcacgtgacc
gaccacagcaacgccgcacgcaccatgctgttcaacatccacgaccaacgctgggacggc
gagctgcttgatgccctccgcatccccgccagcatgatgccgaaatccctgccctcaagc
gccgattttggcctgacccaagccgaatggctgggcgcgccactcaccattggcggggtg
gccggcgaccagcaaagcgccctcttcggccaggcctgcttctcggctggcatggcgaaa
aacacctacggcaccggctgcttcatgctgatgcacaccggcgaacgcttccagatcagc
gagaacggcctcatcaccaccgccgcggcgcagccccccggccggccccaatacgcactc
gaaggcagcgtgttcatcggcggcgcggtgattcagtggctgcgcgacggcctcaacgcc
atccagtccagcagcgaggtgcaggccctggccgagagcgttcccgacaccggtggcgtg
gtgctggtacccgccttcaccggcctgggcgcgccctattggcagcccgatacccgcggc
agcctgaccggcctcacccgcggcaccaccgtggcccacatcgcgcgcgccgcgctggaa
agcatcgctttccagagcaccgcgctgcttgccgccatgagccgcgatgcggtctcggcc
ggtggcgtggaagtgcaggaattgcgggtggacggcggcgcctgcgtcaatgacttgttg
atgcagttccaggctgacttgctgggcatcccggtggttcgccctgctgtgatcgaaacc
actgccctgggcgcggcctatctcgcggggttgcataccggtctgtaccaagggctggac
gaactctcggcccaatggcgcgccgaacgcacatttgagccgcagatggcgcgcgaagag
gccgccgaaaagatgggccgctgggaacacgccgtgcgccaaaccgtcgcgacctag

DBGET integrated database retrieval system