KEGG   Hydrogenophaga sp. LPB0072: LPB072_03740Help
Entry
LPB072_03740      CDS       T04505                                 

Definition
(GenBank) ABC transporter permease
  KO
K17322  glycerol transport system permease protein
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LPB072_03740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyl02000]
    LPB072_03740
Transporters [BR:hyl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glycerol transporter
    LPB072_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AOW12093
UniProt: A0A162YXN8
Position
781064..781960
Genome map
AA seq 298 aa AA seqDB search
MSVQNKPVNQKAWFLILPVLICVAFSAILPLMTVVNYSVQDIISPDRRVFVGTEWFAAVM
RDEDLHAALWNQLRFSAAVLAVELPLGIMLGLSMPASGWKASVTLVVVALSLLIPLNVVG
TIWQIFGRTDIGLMGVTLQALGIEYSYTGNTTHAWLTVLLMDVWHWTPLVALLAYAGLRS
IPDAYYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGN
STTFLSQYLTQKAVGQFDLGPAAAFSLIYFFIILLFCFVLYNWMQRLGQAEKEGAGHG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcaaaacaaacccgtgaaccagaaagcctggttcctgatcctgccggtgctc
atctgcgtggccttttctgccatcttgcctttgatgaccgtggtgaattattcggtgcaa
gacatcatctcgcccgatcgccgcgtgtttgtgggtaccgagtggtttgctgccgtgatg
cgcgacgaagatcttcacgccgccctctggaaccagttgaggttttccgccgccgttttg
gctgtggagttgccgctgggcatcatgctcgggctgtccatgcctgcatccggttggaaa
gcatcggtgaccttggtggtggtggccttgtcgctgcttattcccttgaacgtggttggc
acgatctggcagatcttcggtcgtaccgacattggcctgatgggtgtcacgcttcaagcg
ctggggatcgaatacagctacacgggcaataccacccatgcgtggttgacggtgttgttg
atggatgtgtggcactggacgcctctggtggccctgctcgcttatgcaggccttcgcagc
attcctgatgcctattaccaggccgcccgcattgatggggccagcaaattcgcggtgttc
cgctacatccagttgccaaagatgcgtggcgtgttgatgattgccgtcctgctgcgcttc
atggacagtttcatgatttacaccgagccctttgtgctcacgggcggtgggccaggcaac
tcgaccacgttcctgagccagtacctcacacaaaaagccgtcgggcagtttgatctaggg
cccgctgcagcattttctctgatctattttttcatcatcctgctgttctgcttcgtgctc
tacaactggatgcagcgactcggccaggccgaaaaagaaggagctggtcatggttga

DBGET integrated database retrieval system