KEGG   Hydrogenophaga sp. LPB0072: LPB072_03755Help
Entry
LPB072_03755      CDS       T04505                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K17321  glycerol transport system substrate-binding protein
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LPB072_03755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyl02000]
    LPB072_03755
Transporters [BR:hyl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glycerol transporter
    LPB072_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 DUF4863 FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AOW12096
UniProt: A0A167HE48
Position
783387..785120
Genome map
AA seq 577 aa AA seqDB search
MKFRHTALAVAAIAAFSTNLAWADAAAAKKWIDTEFQPSTLSKDQQAAEMKWFIDAAAKL
KGKGVNEISVVSETIDTHVYESKTLAKAFEEITGIKVKHDLIQEGDVVEKLQTSMQSGKS
IYDGWITDSDLIGTHYRYGKVMNLTDYMAGKGKEWTNPGIDIKDFIGTSFTTAPDGKLYQ
LPDQQFANLYWFRADLFARQDLKDKFKAKYGYELGVPQNWSAYEDIAEFFTDDVKNIDGK
PIYGHMDYGKKDPSLGWRFTDAWLSMAGTADIGIPNGKPVDEWGIRASADGCNPQGASVS
RGGATNSPAAVYALTKYIDWMKKYSPKEAIGMTFGEAGPVPAQGQIAQQIFWYTAFTAGM
IKPGLPVVNADGTPKWRMAPGPNGPYWKQGMQNGYQDVGSWTFFAKHDADRTAAAWLYAQ
FVTAKTTSLKKTIVGLTPIRESDIQSQAMTDMAPKLGGLVEFYRSPARVAWTPTGTNVPD
YPKLAQLWWQNVAQAVTAEKTPQQAMDNLAEQMDQVMARLERAGMDRCAPKLNPKGDPNK
YLSDKAAPWKKLANEKPKGETIAYEQLLNAWKAGRVR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcgccatacagcactcgctgtcgcagccatcgctgcgttcagcacgaatttg
gcctgggccgacgcggctgcagccaaaaagtggatcgacaccgagtttcagccttcgacg
ctgagcaaagaccaacaggccgcagagatgaaatggttcatcgatgctgcggccaagctc
aagggtaagggtgtcaatgaaatatcggtggtttccgagaccatcgatacccacgtctac
gagagcaagaccctggccaaagcctttgaagaaatcacaggcatcaaggtcaagcacgac
ctgatccaggagggcgatgtcgtcgaaaagctccagacctccatgcagtccggcaagtcg
atttacgacggctggatcacagactccgatctgatcggcacccactaccgctacggcaag
gtcatgaacctgaccgattacatggccggcaaggggaaagagtggaccaacccaggcatc
gacatcaaggatttcatcggtaccagcttcaccacggcgccagatggcaagctgtaccag
ttgcctgatcaacagtttgccaacctgtactggttccgcgccgacctgttcgcccgccag
gacctgaaggacaagttcaaagccaaatacggttacgagttgggcgtgccgcagaactgg
agcgcgtacgaagacattgccgagttctttaccgatgatgtgaaaaacatcgacggcaag
cctatctatggacacatggattacggcaaaaaagacccgtcgctgggctggcgcttcacc
gacgcatggttatccatggccggtacagccgatatcggcattcccaacggcaaacctgtc
gatgagtggggtattcgcgcatcggctgatggctgcaatccgcagggcgccagcgtttcc
cgcggcggcgccaccaactcgcctgccgccgtctatgcgctgaccaagtacatcgactgg
atgaaaaaatactcgcccaaggaagccatcggcatgacctttggtgaagcgggtcctgtg
cctgcgcagggccagatcgctcagcaaatcttctggtacaccgctttcacagcaggcatg
atcaagcccggtctgccggtggtcaacgccgatggcacgccgaagtggcgcatggcgcct
ggtccaaatgggccatattggaagcagggcatgcaaaacggctaccaagacgtggggagc
tggaccttcttcgccaagcatgacgccgaccgcacggccgccgcctggttgtatgcgcag
ttcgtgaccgccaagacgaccagcctgaaaaagaccatcgtcggtttgacgcctattcgc
gaatccgatatccagagccaggccatgaccgatatggcgccgaagctgggtggattggtt
gagttttaccgcagcccagcacgtgtggcctggacacccaccggtaccaacgtgcctgat
tatcccaagctggcccagctctggtggcaaaacgtggctcaggctgtgacggcagagaag
acacctcagcaggccatggacaatctcgcagagcagatggaccaggtgatggcccgtctg
gagcgtgcaggcatggaccgctgtgcgcccaagctcaaccccaagggagaccccaacaag
tacctgagcgacaaggccgccccttggaagaaactggccaacgagaagcccaaaggcgag
accatcgcctacgagcaactgctcaatgcctggaaggccggtcgcgttcgttga

DBGET integrated database retrieval system