KEGG   Hydrogenophaga sp. LPB0072: LPB072_03795Help
Entry
LPB072_03795      CDS       T04505                                 

Definition
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LPB072_03795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hyl03011]
    LPB072_03795
Ribosome [BR:hyl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LPB072_03795
  Bacteria
    LPB072_03795
  Archaea
    LPB072_03795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: AOW12104
UniProt: A0A167HE88
Position
789562..789927
Genome map
AA seq 121 aa AA seqDB search
MLTKKEQRLRRARQTRIRIAQQSAVRLTVNRTNLHIYAAVISDDGSRVLASASTAEAEMR
TQIGGAGKGGNTAAAALIGKRIAERAKAAGIEKVAFDRSGFAYHGRVKALADAAREAGLQ
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaaaaaagagcaacgtctgcgtcgtgcgcgtcaaacgcgtatccgtattgcg
caacaaagcgccgtgcgcctgaccgtgaaccgcaccaacctgcacatctacgccgccgtc
atctccgacgatggttcccgtgtgctggcatcggcctcaacggccgaagccgagatgcgt
acccaaatcggtggtgctggcaagggtggcaacaccgctgctgcggccctgatcggcaag
cgcatcgctgagcgggcaaaagccgcaggcatcgaaaaggtcgcttttgaccgttcgggc
tttgcttaccatggtcgggtcaaggcccttgcagatgccgctcgtgaagccggcctgcag
ttctga

DBGET integrated database retrieval system