KEGG   Hydrogenophaga sp. LPB0072: LPB072_03835Help
Entry
LPB072_03835      CDS       T04505                                 

Definition
(GenBank) DNA-directed RNA polymerase subunit alpha
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    LPB072_03835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hyl03021]
    LPB072_03835
   03400 DNA repair and recombination proteins [BR:hyl03400]
    LPB072_03835
Enzymes [BR:hyl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     LPB072_03835
Transcription machinery [BR:hyl03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     LPB072_03835
DNA repair and recombination proteins [BR:hyl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      LPB072_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_A_CTD RNA_pol_A_bac RNA_pol_L RNA_pol_L_2 DUF211
Motif
Other DBs
NCBI-ProteinID: AOW12112
UniProt: A0A163CBR3
Position
794296..795282
Genome map
AA seq 328 aa AA seqDB search
MLNNLLKPKTINVEQVSTNRAKVTLEPFERGYGHTLGNALRRVLLSSMVGHAPTEVTIAG
VVHEYSSIDGVQEDVVNMLLNLKGVVFKLHNRDEVTLSLRKDGEGIVTAADIQTPHDVEI
VNPEHVIATLSGGAKLDMQIKVEKGRGYVPGSLRRNDDQSRSLGRIVLDASFSPIKRVSY
TVESARVEQRTDLDKLVLEIETNGSIGPEEAVRASAKILVEQLAVFAQLEGLELSAFDQP
AQRSSQQFDPILLRPVDELELTVRSANCLKAENIYYIGDLIQRTENELLKTPNLGRKSLN
EIKEVLASRGLTLGMKLENWPPAGLDKH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacaatctgctcaagcccaaaacaatcaatgtcgaacaagtttcgacgaaccgc
gccaaggtcacgctcgagcctttcgaacgtggctacgggcataccttgggcaatgccctg
cgtcgggtgctgctttcttccatggtcggccatgcgccaaccgaagtgacgattgccggg
gttgtacatgagtactcctctattgacggtgtccaggaagacgtcgtcaacatgctgctc
aacctcaaaggtgtggtgttcaaactccacaaccgcgatgaagtgacgcttagcctgcgc
aaggatggcgaagggatcgtgacggcagctgacattcaaacgccccacgatgttgaaatc
gtcaatccagaacacgtgattgccacgctctccggcggtgccaagttggatatgcagatc
aaggtcgaaaagggtcgcggctatgtgcccggtagcctgcgtcgcaatgacgaccagtcg
cgctcgcttggacgcatcgtgttggacgcttctttttctccgatcaagcgcgtcagctac
acggttgaaagtgcacgcgtcgagcagcgcaccgatctggacaagcttgttctggaaatc
gaaaccaatggttcgataggcccggaagaagcggttcgcgcttcggccaagatcctcgtt
gagcagttggccgtgttcgcgcagttggaaggtctggagctctccgcttttgatcagccg
gctcaacgcagttcacaacagttcgatccgatcttgttgcgtcctgtcgacgagcttgag
ttgacggttcgttctgccaactgcttgaaggcggagaacatctactacatcggtgatctg
atccaacgcaccgaaaacgagttgctcaagaccccgaatctgggtcgcaagtcactcaac
gagatcaaggaagtgcttgcttcgcgcggcctgaccttgggtatgaagcttgaaaactgg
ccaccagctggcctggacaagcactga

DBGET integrated database retrieval system