KEGG   Hydrogenophaga sp. LPB0072: LPB072_03935Help
Entry
LPB072_03935      CDS       T04505                                 

Definition
(GenBank) mononuclear molybdenum enzyme YedY
  KO
K07147  methionine sulfoxide reductase catalytic subunit [EC:1.8.-.-]
Organism
hyl  Hydrogenophaga sp. LPB0072
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LPB072_03935
Enzymes [BR:hyl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.-  Acting on a sulfur group of donors
    1.8.-.-  
     LPB072_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb DUF4827
Motif
Other DBs
NCBI-ProteinID: AOW12126
UniProt: A0A162P3S1
Position
complement(814881..815879)
Genome map
AA seq 332 aa AA seqDB search
MIIRNPAEGFDHPLSSEITSPSQYLNRRTWLQTLALGAGGAALSSWATREAWALASRPGR
LAALNASASNVAGAQTIEKLTGYKDASSYNNYYEFSTDKAEPAALATTLQTQPWTVAVEG
MVNKPKVFDLDALLKLSAMEERIYRLRCVEGWSMVIPWLGYSLAALIKEVQPQGSARYVE
FVTLADPKMMPGLSSGVLDWPYTEALRLDEALHPLTMLGFGMYGEVLPNQNGAPVRLIVP
WKYGFKSAKSLVKIRFTDRQPNTAWNKAAAQEYGFYSNVNPDVPHPRWSQSTERRIGEEG
GLFAKRRKTLIFNGYEAQVGQLYAGMDLRKNF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcatccgaaaccccgccgaaggatttgaccatcccctttcgagcgaaatcacctcg
ccatcccaatacctgaatcgccgcacctggttgcaaacgctggcgctgggggccggtggg
gcagccttgtcaagctgggcaactcgcgaggcttgggcattggcatcccggcccgggcgg
ctcgctgcgctgaatgccagcgcctctaacgtggctggtgctcaaacgatagaaaagctc
accggctacaaagacgcatcctcgtacaacaattactacgagttcagcaccgacaaggcc
gaaccggccgctttggcaaccacactccaaacgcaaccctggacggtggctgttgaagga
atggtcaacaagcccaaggtctttgatctcgacgctttgctcaagctcagtgccatggaa
gaacgcatctaccgcctgcgctgcgtcgaaggctggtccatggtgattccatggttaggc
tattccctggccgctctgatcaaagaagtgcaaccgcaaggcagtgccagatatgtggaa
tttgtcaccttggccgatcccaaaatgatgccaggtctgagctccggcgtgcttgactgg
ccatacacagaggcgctgaggctggacgaggccctgcaccccctgaccatgctgggcttc
ggcatgtatggcgaggtgctgcccaaccagaatggtgcccccgtgcgcctgatcgtgccc
tggaaatacggattcaaatcagccaagtcgctggtgaaaatacgcttcaccgatcgccag
ccaaacaccgcatggaacaaggctgcggcacaagaatatggcttttactccaatgtgaat
ccggatgtgccacatccccggtggagccaatcaactgagcgacgcattggcgaagaaggg
ggcttgttcgccaagcgccgaaaaaccctcatcttcaatggctacgaagcccaggtgggt
cagctttacgcaggcatggacctgcgaaagaatttttga

DBGET integrated database retrieval system