KEGG   Hydrogenophaga sp. LPB0072: LPB072_03975Help
Entry
LPB072_03975      CDS       T04505                                 

Definition
(GenBank) hypothetical protein
Organism
hyl  Hydrogenophaga sp. LPB0072
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_9 PAS_4 PAS HATPase_c PAS_3 HisKA PAS_8 PAS_10 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AOW12132
UniProt: A0A162YXU3
Position
824614..826722
Genome map
AA seq 702 aa AA seqDB search
MHRKDPEPNIMETLATSETSLETSPELERLVALRTQALQADLDRANRRFENAPCGHLMLD
GALRLMDINQTLLEWLGYQRDELLDPSINLTTLVDSAWYQLMQPRLEAIGQSDSVESMEL
DLIRKDGSRFQALLTCTAVKDAEGQFLYSHSSVVDISERKNTEQRVAAHDGFLQTITDRI
PVELAYFDKDLNCRFANRAHAARYGRQPEDMAGENLSNLVDADKLPEILPFVAEALSGQN
QTFESEYLGTDGRRSYFEVHYIPDQRKGDIEGIFIELHDISESRRTEEFVLEANRDLEER
VRERSAELFQSEQRYRLMVDAIQDHCIYFVDEHGAVTEWTESAQRLHGHSRQQMLGRPYQ
NLLAIGNAGEDEVDPEQVLRLAKAHGQWETRGWRLRDDGSRFWAHTVLTALRNEGGELQG
LSAITRDMTAAKSLEDVMNDLNKELEKRVAERTQQLVAANKDLDVFSHMVSHDLRAPLRH
ISSFVTLLQEQLGESSDRLTLQYLNSTAKASRRMSYMIEGLLEYARLGRVTLDSQPVPLA
PLLDGVIAHLKMENPDRQIEWVIEEDLPVVRGDAMLLAQAWGNLLNNSVKYTRTREAGRI
EVGWKVNPVGGRTFFVRDNGVGFDLEKAHNLFVMFQRQHHSMDFDGTGTGLALSQRIVER
HGGRIWAETAPDEGCTFYFTLPFEGTEPELEFPASSMAELAY
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgcaaagacccggagcccaacatcatggaaacacttgccacttctgaaacgagc
ctggaaacaagccccgagctggagcgcttggtggctttgcgcacccaagcgttgcaagcc
gacttggatcgcgccaaccgacggttcgaaaatgcaccctgcggccatctgatgctggat
ggggcgttgcggttgatggacatcaaccaaaccctgctggaatggctgggctaccaacgg
gacgaattgctcgacccgtcgatcaacctgacgactttggtggactcggcctggtaccaa
ctgatgcagccgcgcctggaggccatcgggcaatcagattctgttgaatcgatggaactg
gatctgattcgcaaggacggcagccgttttcaggccctgctcacttgcacggcagtcaaa
gacgctgagggacagttcttgtacagccactccagcgttgtcgatatcagcgagcgcaaa
aacaccgagcaacgggttgctgcacacgatggcttcctgcagaccattaccgatcgcatc
cccgtcgagttggcctactttgacaaagacctcaactgccggtttgccaaccgagcccat
gcggcccgctacgggcggcagcccgaagacatggcgggtgaaaacctgagcaacctggtg
gatgccgacaagctgccggaaatcctgccattcgtggccgaggcgctgagtggccaaaac
cagacttttgagtcggaatacctggggactgacggacgtcgaagctattttgaagtgcac
tacatccccgatcaacgaaagggtgatatcgagggcatcttcattgagttgcacgacatc
agcgaaagccgtcgaacagaggagttcgtgctcgaagcgaaccgcgatctggaggaacgg
gtgcgtgagcgcagcgccgaactgttccaaagtgagcagcgctaccgcttgatggtggat
gccatccaggaccactgcatctatttcgtggacgaacacggtgccgtgaccgagtggacg
gaaagcgcccaacgtctgcacgggcattcgcgtcagcaaatgctgggccgcccctaccag
aacctgttggccatcggcaacgccggtgaggacgaagtggatcccgaacaggttctccgt
ctggcaaaagcccatggccaatgggagacccggggttggcgccttcgcgacgatggctca
cgcttctgggcccacaccgtgctcacagccttgcgcaacgagggcggtgagctgcaaggt
ttgtctgcgattacgcgtgacatgacagcagccaagagtctggaggacgtgatgaacgac
ctcaacaaggaacttgagaaacgtgtggcagagcgcacccagcaactggtggcggcgaac
aaagacctcgatgtgttttcccacatggtgtcgcatgatttgcgcgccccactgcgtcac
atatccagttttgtcaccttgttgcaagagcaactgggcgaatccagcgaccgcctcacc
ctgcagtacctgaattccacagccaaggccagccgccgcatgagttacatgatcgaaggc
ttgttggagtacgcccgtctgggccgagtcacgctggactcccaacccgtgcccttggct
cccttgctggatggggtcatcgctcatctcaagatggaaaaccccgaccgccagatcgag
tgggtgatcgaagaggacttgccagtggtgcgcggcgacgccatgttgctggcgcaggct
tggggcaacttgttgaacaactcggtgaagtacaccagaacccgggaagccgggcgcatt
gaagtgggctggaaagtcaaccctgtgggtggccgcaccttcttcgttcgtgacaacggc
gtgggtttcgatctggagaaggcccataacctgttcgtcatgttccagcgccagcaccac
tccatggacttcgatggcacgggtaccggcctggcactgtctcaacgcatcgttgagcgc
cacggaggtcgaatctgggcagaaacggcacccgatgaaggctgcaccttctacttcacg
ttgccattcgaaggcaccgaacccgaactggagtttcctgcctcgtcgatggcggagctg
gcttattga

DBGET integrated database retrieval system