KEGG   Hydrogenophaga sp. LPB0072: LPB072_03980Help
Entry
LPB072_03980      CDS       T04505                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00450  Selenocompound metabolism
hyl00970  Aminoacyl-tRNA biosynthesis
hyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LPB072_03980
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LPB072_03980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hyl01007]
    LPB072_03980
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hyl03016]
    LPB072_03980
Enzymes [BR:hyl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LPB072_03980
Amino acid related enzymes [BR:hyl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LPB072_03980
Transfer RNA biogenesis [BR:hyl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LPB072_03980
 Prokaryotic type
   Other AARSs
    LPB072_03980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AOW12133
UniProt: A0A167HEN5
Position
complement(826805..828949)
Genome map
AA seq 714 aa AA seqDB search
MSQPRRLFVTTALPYANGHFHIGHIMEYIQADIWVRFQRMRGNEVHFVCADDAHGAPIMI
AAEKAGKTPQQFVADIASGRKPYLDGFHIAFDNWHNTDAPENHELAQDVYRALKANDLIE
TRSIEQFFDPEKGMFLADRFIKGECPKCGTKDQYGDNCENCGAVYAPTELKNPYSALSGA
VPVLKSSDHFFFKLSDPRCIEFLNGWTNSGAVQPEVLNKITEWIAPGEDGKPKMGDWDIS
RDAPYFGIQIPDAPGKYFYVWLDAPIGYLASLKNHFGKIGVDYDAFMADPTTEQYHFIGK
DIITFHTLFWPAMLKFSGRKVPNAVFVHGFLTINNGEKMSKSRGTGLNPLKYLELGMNPE
WLRYYLAAKLSGKNEDVDFNPEDFMLRVNSDLVGKYINIASRAAGFIAKRFDGKLGAASA
DGAALLASIQDIAIEVTDLYAEREYGKALREIMLQADKVNAYVDQNKPWELAKKEGQEAR
LQDVCSTCIEAFRLISLYLKPVLPALAANVEAFLKIEPLTFSDAGKLLGAGHAIGAYQHL
MQRVDVKQLDALFEPPPAPLVEKPLAGDERRSAPTLAASPGSPPPEMAALALGLPGGEAI
APTITIDDFAKIDLRIAQIVNCEAVEGSVKLLRLTLDVGEGQTRNVFSGIASAYKPEDLV
GKLTVMVANLAPRKMKFGLSEGMVLAAGHADEKAEPGIYILNPWPGAKPGMRVR
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgcgccgccttttcgttaccaccgccctgccctacgccaacggccatttc
cacatcggccacatcatggaatacatccaggccgacatctgggtgcgcttccagcgcatg
cgcggcaacgaagtgcacttcgtctgcgccgacgatgcccacggcgcacccatcatgatc
gcggccgaaaaggccggcaaaacgccccagcagttcgtggccgacattgcctcgggccgc
aagccctacctcgacggctttcacattgccttcgacaactggcacaacaccgacgcaccc
gaaaaccacgagcttgcacaagacgtgtaccgcgccctgaaagccaacgacctgatcgaa
acacgctccatcgagcagttcttcgaccctgaaaaaggcatgttcctggccgaccgcttc
atcaagggcgagtgtcccaaatgcggcaccaaagaccagtacggcgacaactgcgaaaac
tgcggtgccgtgtacgcgcccaccgaactgaagaacccctattcggccctgtctggcgcg
gtgccggtgctcaagagctccgaccactttttcttcaaactctccgacccccgctgcatc
gagttcctgaacggctggaccaacagcggcgcggtgcagcccgaggtgctgaacaagatc
accgagtggatcgcaccgggcgaagacggcaagcccaagatgggcgactgggacatcagc
cgcgatgcgccctacttcggcatccagattcctgatgcaccgggcaagtatttttacgtc
tggctggacgcgcccattggctacctcgcctcgctgaaaaaccacttcggcaagatcggc
gtggactacgacgccttcatggccgacccgacgaccgagcagtaccacttcatcggcaaa
gacatcatcaccttccacacgctgttctggccggcgatgctgaagttcagcggccgcaaa
gtacccaacgccgtgtttgtgcacgggtttctcaccatcaacaacggcgagaagatgagc
aagagccggggcaccggtctgaacccgctgaagtacctcgagctcggcatgaaccccgag
tggctgcgctattacctcgcggccaagctcagcggtaaaaacgaagacgtcgatttcaac
cccgaagacttcatgttgcgcgtcaacagcgatctggtggggaaatacatcaacatcgct
tcccgcgctgcaggtttcatcgccaagcgctttgacggcaagctgggcgccgcctcggcc
gatggcgcggcactgctggcatcgattcaggacatcgccatcgaggtgaccgatctgtac
gccgagcgcgagtacggcaaagcattgcgcgaaatcatgctgcaggccgacaaggtcaac
gcctatgtcgaccagaacaagccctgggaactggcaaagaaagaaggccaggaggctcgc
ctgcaagacgtgtgcagcacctgcatcgaagccttccgcctgatctcgctctacctgaaa
ccagtgctgcccgcactggcggccaacgtggaggctttcctcaagatcgagccgctcaca
ttcagcgacgcgggcaaactgctcggcgcaggacacgccattggtgcctaccagcacctg
atgcagcgcgtggacgtgaagcagcttgacgcgctgttcgagccgcctcctgcccccttg
gtcgaaaaacccctagccggtgacgaaaggcgcagcgcccccacactcgctgcttcgcct
ggttcgccccctcccgagatggctgcgctcgccctggggctgcccggcggcgaggccatc
gcccccaccatcaccatcgacgacttcgccaagatcgacttgcgcatcgcccagatcgtg
aactgcgaagcggtggaaggctcggtcaagctgctgcgcctgacgctcgacgtgggtgaa
ggtcagacccgcaatgtcttcagcggcatcgccagcgcctacaagcccgaagacctggtg
ggcaagctcactgtgatggtggccaatctggcgccgcgcaagatgaaattcgggttgagc
gaaggcatggtgctggctgccggccatgccgacgaaaaagccgaacccggcatctacatc
ctgaacccatggccaggcgccaaacccggcatgcgggtgcgctga

DBGET integrated database retrieval system