KEGG   Hydrogenophaga sp. LPB0072: LPB072_04095Help
Entry
LPB072_04095      CDS       T04505                                 

Definition
(GenBank) hypothetical protein
Organism
hyl  Hydrogenophaga sp. LPB0072
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1566
Motif
Other DBs
NCBI-ProteinID: AOW12150
UniProt: A0A167HF33
Position
complement(853199..854998)
Genome map
AA seq 599 aa AA seqDB search
MKTRVAGCAASLVILLSACGGGTGDKPVPERSTVQQAGASTESPLSTEALLALGARLNTS
ALKEAESEALAADQLGARTGLDQLAPGEQAPWSAYASGAVREKAADKLVPVWRFYNGATG
AHFFTRNATERDNVIANLSPPKGSFQYEGEAFKVANAPSPGLSPVHRFYNTQTGVHFYTI
SDTERTHITTNLPQFAYEGIAYYASKVNGGGMTPFYRFYLPGKGFHFYTASLQERDNIIA
NLAAIYQYEGAGYSVLQSNWQPEPEPPAVVPHSGMKDTQCVAFGSFGSYVSCADPNAQAL
NPQQDGHRANTNPMSYSAIGAYPTTSCVKDNVTGLIWEGKTANNEPRGGGTVYTNYPFGY
GKTDDASGYITYVNGLNLCGYSDWRLPTRTELLGIVDFGRYEPALDSAWFPNSNHTYWTA
DKLGWDNGYSATVTFTSGYTGAASASKERIRLVRGYGHTTQRYSYGTVAYGSDATNNVVI
DGWTGLRWRRCEQGRTWTGATCSGTASTLTHYDALTHARDLTGWRLPNVKELASLVSLGV
ASGTTIDSTAFPGAAAANLWSSTPWDLLGRARYVGFADGRVSASPHNTAYPVRLVQLIP
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccagggtagcgggttgtgcagccagtctggttattctgctcagcgcctgcggc
ggcggcactggcgacaagccggtaccagagcgatccaccgtgcagcaagccggggcttcc
accgaatccccgctgtccactgaagctttgctggccctgggcgccaggctcaacacctct
gccttgaaagaggctgagagcgaggccctcgccgctgaccagttgggtgcgcgaaccggt
ctcgaccaattggcccctggtgagcaggccccctggagcgcctacgcctcaggcgccgtt
cgggagaaagcggccgacaagctcgtgcccgtctggcggttttacaacggcgccacagga
gcccatttcttcacccgcaatgcgaccgagcgcgacaacgtgatcgccaacctgtcgccc
cccaagggcagttttcagtacgaaggtgaggccttcaaagtggccaacgcgccttcgcct
gggctctcaccggttcaccgtttctacaacacccagaccggcgttcacttctacaccatc
agcgacaccgagcgcacccacatcacaaccaacctgccccagtttgcctatgaaggcatt
gcgtattacgccagcaaggtgaacggtgggggcatgacgccgttttaccgtttctacctg
ccgggcaaagggtttcatttctacacggccagtctgcaggaacgcgacaacatcatcgcc
aacctggcggccatttaccaatacgaaggggcgggatattcggtgctgcaaagcaactgg
caacctgagccggaaccgcccgcggtggttccgcattcgggtatgaaagacacccagtgt
gtggcgttcggctcttttggcagctacgtgtcgtgtgccgatcccaatgcacaggcgctc
aacccgcaacaagatggccaccgtgcaaataccaatcccatgagctacagcgccattggc
gcctacccgaccaccagttgcgtgaaagacaacgtgaccgggttgatctgggagggcaaa
accgccaacaacgagccgaggggtggggggaccgtttacaccaactaccccttcggctac
gggaaaacggacgacgcgagtggctacatcacctacgtcaatggcctcaacctctgcggc
tacagtgactggcgcctgcccacacgaacggaattgcttgggatcgtggactttggacga
tatgagccggcactggacagtgcctggttccccaactcgaaccacacctactggaccgca
gacaaactgggctgggacaacggctattcggcaacggtcacgttcacctccggctacacc
ggcgcagcatctgcaagcaaggagcgcatccggctggttcgcgggtacggacacacgacc
cagcggtacagctatggcacggtggcatacggctcagacgcgacaaacaacgtggtcatc
gacggatggacgggcctgcgctggcgccggtgtgagcaaggacggacctggaccggcgcg
acctgctcgggcactgcaagcacattgacccactacgacgcactgacccacgccagagac
ctgaccggctggcgcctgcccaacgtgaaggagctggcaagcctcgtttcgctgggcgtt
gccagtggcacaacgattgactcgacggcatttccgggggctgcagcggccaacctctgg
tcctccaccccctgggacctgctgggcagagcccgttatgttggtttcgctgatggccgc
gtaagtgcctctcctcacaacacggcttatcccgtccgtctggtgcaactcataccgtga

DBGET integrated database retrieval system