KEGG   Hydrogenophaga sp. LPB0072: LPB072_04135Help
Entry
LPB072_04135      CDS       T04505                                 

Gene name
livF
Definition
(GenBank) branched-chain amino acid ABC transporter ATP-binding protein
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl02010  ABC transporters
hyl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LPB072_04135 (livF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LPB072_04135 (livF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyl02000]
    LPB072_04135 (livF)
Transporters [BR:hyl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    LPB072_04135 (livF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 BCA_ABC_TP_C SMC_N AAA_29 AAA_23 AAA_27 AAA_16
Motif
Other DBs
NCBI-ProteinID: AOW12157
UniProt: A0A162P3V8
Position
862727..863434
Genome map
AA seq 235 aa AA seqDB search
MLTFDNVSLSYGSFLALDGVSLHAESGELVVLLGANGAGKSSIFLTASGIHKAAGGSIRF
GDKELVGRKPSQIVANGLVQCPEGRKLFPQMSVLKNLMLGAYVHRGDKAGNRQRLEEVMA
LFPILDEKKDDTAGSLSGGQQQMVAIGRAMMGRPKVLLLDEPSLGLAPLVVKQVFEVIQR
INKSGTTVLLAEQNAYAALKIANRAYVMERGRIVLEGDRESLMNNEAVRRAYIGA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgtttgacaacgtatccctgtcctacggcagcttcctcgcgctcgacggtgtt
tccctgcatgccgaaagcggcgagctggtggttttgctcggcgccaacggcgccggcaag
agctccatctttctgaccgccagcggtatccacaaagccgccggcggcagcatccgcttt
ggcgacaaggaactcgtgggccgcaagccctcgcagatcgtggccaacggcctggtgcag
tgccccgaaggccgcaagctgtttccgcaaatgtcggtgctgaaaaacctgatgctcggc
gcctatgtgcaccgcggcgacaaggcgggcaaccgccagcgcctggaagaggtgatggcg
ctgttccccattctggatgaaaagaaagacgacacggcgggctcgctgagcggtggccag
caacagatggtggccattggccgcgccatgatgggccgcccgaaagtcctgctgctcgac
gagccttcgctgggcctggccccgctggtggtcaagcaggtgtttgaagtcattcagcgc
atcaacaaatcgggcaccaccgtgttgctggccgaacaaaacgcctacgccgccctcaag
atcgccaaccgggcgtatgtgatggagcgtgggcgcatcgtgcttgaaggcgaccgcgaa
agcctcatgaacaacgaagccgtgcgccgcgcctacatcggcgcctga

DBGET integrated database retrieval system