KEGG   Hydrogenophaga sp. LPB0072: LPB072_10965Help
Entry
LPB072_10965      CDS       T04505                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00071  Fatty acid degradation
hyl00072  Synthesis and degradation of ketone bodies
hyl00280  Valine, leucine and isoleucine degradation
hyl00310  Lysine degradation
hyl00362  Benzoate degradation
hyl00380  Tryptophan metabolism
hyl00620  Pyruvate metabolism
hyl00630  Glyoxylate and dicarboxylate metabolism
hyl00640  Propanoate metabolism
hyl00650  Butanoate metabolism
hyl00900  Terpenoid backbone biosynthesis
hyl01100  Metabolic pathways
hyl01110  Biosynthesis of secondary metabolites
hyl01120  Microbial metabolism in diverse environments
hyl01130  Biosynthesis of antibiotics
hyl01200  Carbon metabolism
hyl01212  Fatty acid metabolism
hyl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB072_10965
   00630 Glyoxylate and dicarboxylate metabolism
    LPB072_10965
   00640 Propanoate metabolism
    LPB072_10965
   00650 Butanoate metabolism
    LPB072_10965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPB072_10965
   00072 Synthesis and degradation of ketone bodies
    LPB072_10965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPB072_10965
   00310 Lysine degradation
    LPB072_10965
   00380 Tryptophan metabolism
    LPB072_10965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPB072_10965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPB072_10965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPB072_10965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyl04147]
    LPB072_10965
Enzymes [BR:hyl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPB072_10965
Exosome [BR:hyl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPB072_10965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin DUF5423 SE
Motif
Other DBs
NCBI-ProteinID: AOW13297
UniProt: A0A163CE69
Position
complement(2381958..2383163)
Genome map
AA seq 401 aa AA seqDB search
MSEAFVYDAIRTPRGKGKKDGSLHEVKPVNLLAGLLRDLQARNGFDTAAVDDIVMGVVSP
IGEQGSVLPKVAALKAGWDWRCSGVQLNRFCASGLEAVNMAAMKIKSGWEDLVVAGGVEC
MSRVPIGSDGGAWAQDPETNSETLFVPQGVGADLIATMAGFSRADVDAFALESQKRATKA
RAEGRFAGSIVPVKDFLGQTILGEDEFIKPNTTLEGLAGLKPAFEQLGAMGFDAVALQRY
PQVERIYHVHHAGNSSGIVDGAAAVLIGSEAAGKAHGLKARAHIVSVALSGDDPTIMLTG
PMPAARKALAKAGLTIDQIDLFEVNEAFATVPMKFMQAMGVPHEKVNVNGGAIAMGHPLG
ATGAMILGTLIDELHRTGKRYGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagcatttgtttacgacgccatccgcactccgcgtggcaaaggcaagaaagac
ggcagcctgcatgaagtcaaaccggtcaacttgctcgcgggcctcttgcgcgatctgcaa
gcgcgcaatggttttgatacggcggcggtggacgacatcgtcatgggcgtcgtgtcgccc
attggtgaacaaggctcggtgctgcccaaggtggcggcgctcaaggccggctgggactgg
cgctgctcgggcgtgcagctcaaccgcttttgcgcctcggggctggaagccgtgaacatg
gccgcgatgaaaatcaagagcggctgggaagacctggtggtcgccggcggcgtggagtgc
atgagccgcgtaccgattggttccgatggcggggcctgggcgcaagaccctgaaaccaac
agcgaaacgctgttcgtgccgcaaggagtgggcgccgatctgatcgcaaccatggcgggc
ttcagccgcgccgatgtcgatgcttttgcactcgaatcgcaaaaacgcgccacaaaagcg
cgtgccgagggccgctttgccggatccatcgttcccgtgaaagacttcttgggccaaacc
atcctgggtgaagacgagttcatcaaacccaacaccaccctggaaggcctggccggcctc
aaacccgcttttgaacagcttggcgccatgggcttcgacgccgtggccttgcagcgctac
cctcaggtggaacgcatttaccacgtgcaccacgccggcaactcctcgggcattgtcgac
ggcgcagcggcggtgttgatcggctctgaggccgccggcaaagcccacggcctgaaggcc
cgggcacacattgtgtcggtggcactctccggcgatgacccgaccatcatgctcaccggc
cccatgcctgccgcccgcaaggcgctggccaaagccgggctcaccatcgaccagatcgac
ttgttcgaagtgaacgaagcgtttgccaccgtgccgatgaagttcatgcaggcaatgggc
gtgccgcacgagaaggtgaacgtcaacggcggcgccattgccatgggccatccattgggt
gccaccggggcgatgattctcggcacgctgatcgatgaactgcaccgcacgggcaaacgc
tacggtcttgcaaccctgtgtgtcggcggcggcatgggaatagccacgattattgagcgc
gtataa

DBGET integrated database retrieval system