KEGG   Hydrogenophaga sp. LPB0072: LPB072_18200Help
Entry
LPB072_18200      CDS       T04505                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00362  Benzoate degradation
hyl00621  Dioxin degradation
hyl00622  Xylene degradation
hyl01100  Metabolic pathways
hyl01120  Microbial metabolism in diverse environments
hyl01220  Degradation of aromatic compounds
Module
hyl_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPB072_18200
   00622 Xylene degradation
    LPB072_18200
   00621 Dioxin degradation
    LPB072_18200
Enzymes [BR:hyl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     LPB072_18200
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     LPB072_18200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AOW14479
UniProt: A0A162W362
Position
3943582..3944625
Genome map
AA seq 347 aa AA seqDB search
MTTLKGKKITVHDMTLRDGMHPKRHLMTLDQMKTIACGLDDAGVPLIEVTHGDGLGGSSV
NYGFPAHSDEEYLGTVIPLMKQAKVSALLLPGIGTVDHLKMAHGLGVNTIRVATHCTEAD
VSEQHITFARQLDMDTVGFLMMAHMASPEKLVEQAKLMEHYGANCIYVTDSAGHLLPETV
KARVGAVREALKPETELGFHGHHNLAMGVANSLAAIEVGANRIDAAAAGLGAGAGNTPME
VFIAVCDLMGIETGVDVFKIQDVAEDLVVPIMDFPIRIDRDALTLGYAGVYGSFLLFAKR
AEKKYGVSARDILVEMGRRGMVGGQEDMIEDTAMTMARERGIMAKAA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactcaaaggcaagaagatcaccgttcacgacatgaccctgcgcgacggcatg
caccccaagcgccatctgatgacactggaccagatgaagaccatcgcctgcgggctcgac
gacgccggcgtgccgctgatcgaagtgacccacggcgacggcctgggtggcagctcggtc
aactacggcttcccagcccacagcgacgaggaatacctgggcaccgtcattccgctgatg
aaacaggccaaggtcagcgccttgctgctgcccggtattggtaccgttgaccacctgaaa
atggcccatggcctgggcgtgaacacgatacgcgtggcgacccactgcaccgaggccgac
gtgtcagagcagcacatcacgttcgcccgccagctcgatatggacacggtgggatttctg
atgatggcccacatggccagcccggaaaaactggttgaacaggccaaactgatggagcac
tacggcgccaactgcatctacgtgaccgactcggccggccacctgctgcccgagacagtg
aaggcgcgggtgggcgcggtgcgcgaagcgctcaaacccgagaccgaactgggctttcat
ggccaccacaacctcgccatgggcgtggccaacagcctggctgcaatcgaggtcggagcg
aaccgcatcgatgcggccgctgccgggctgggcgcgggtgcgggcaacaccccgatggaa
gtgttcatcgcggtgtgcgatctgatgggcatcgagaccggcgtggatgtgttcaagatc
caggacgtggccgaagatctggtggtgcccatcatggatttccccatccgcatcgaccgc
gatgcactcacgctgggctacgccggcgtctacggcagttttctgctgttcgccaagcgc
gccgaaaaaaaatacggcgtgtcggcgcgcgacatcctggtcgagatgggccgccgcggc
atggtcggcggccaggaagacatgatcgaagacacggcgatgaccatggcgcgcgagcgc
gggatcatggccaaagctgcctga

DBGET integrated database retrieval system