KEGG   Hydrogenophaga sp. LPB0072: LPB072_18925Help
Entry
LPB072_18925      CDS       T04505                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hyl  Hydrogenophaga sp. LPB0072
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hyl03016]
    LPB072_18925
Enzymes [BR:hyl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     LPB072_18925
Transfer RNA biogenesis [BR:hyl03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    LPB072_18925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOW14589
UniProt: A0A167IPU5
Position
4088065..4088787
Genome map
AA seq 240 aa AA seqDB search
MQLEILYRDEHLIAIDKPPGLLVHRTGLDAGETRFAVQLLRDQIGQPVWPAHRLDKGTSG
VLLFSLNADTARLVGQAFEQGPGVQKTYQAIVRGWAKPEGPIDHALKRMPDDMRFGREEM
QEAQTRFATLAHGELPLPYDAFPATRFSRVALQPLTGRRHQLRRHMKHISHPILGDTTHG
KGPLNRAVAAFIGVQRMWLHATTLALPHPATGRALNINAEPGPEWAFWHSHSEEAPEQGR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggaaatcctctaccgcgacgaacacctcatcgccatcgacaaaccccctggc
ctgctggtgcaccgcaccggcctggacgcgggcgaaacccggtttgcggtgcaactgctg
cgcgaccagattggccaaccggtttggcccgcccaccggctcgacaaaggcaccagcggc
gtgctgctgttttcgctcaatgccgacaccgctcggctggtgggccaggccttcgagcaa
ggcccgggcgtgcagaaaacctaccaggccatcgttcgcggctgggcgaaacccgagggc
ccgattgaccacgccctcaaacgaatgcccgacgacatgcgtttcggacgcgaagagatg
caggaagcacaaacacgatttgcaaccctggcccacggcgaactgcctttgccctatgac
gcgttcccggctacccgcttctcgcgggtggcgctgcaacccctgacaggccggcgccac
caattgaggcggcacatgaagcacatctcccaccccatccttggcgacaccacccacggc
aaagggccgctcaaccgtgccgtggcggcgttcatcggcgtgcaacgcatgtggctgcac
gccaccacgctggcgctgccccacccagcgacggggcgagcgctgaacatcaacgccgag
ccgggccctgaatgggcgttctggcactcgcacagcgaagaagcgcctgaacagggacgt
tga

DBGET integrated database retrieval system