KEGG   Hymenobacter sp. APR13: N008_05200Help
Entry
N008_05200        CDS       T03213                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00250  Alanine, aspartate and glutamate metabolism
hym00330  Arginine and proline metabolism
hym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N008_05200
   00330 Arginine and proline metabolism
    N008_05200
Enzymes [BR:hym01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     N008_05200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AII51380
UniProt: A0A076HNH4
Position
1198939..1200603
Genome map
AA seq 554 aa AA seqDB search
MANGFFNVPTPINEPVKGYAPNSPERIELLKTLKELKQQQRDIPMHIGGQEIRTGRKQNI
TPPHDHQHVLGQFHEGDASHVAQAIDAALAARPLWAEMPWEHRAAIFLKAADLLAGPYRA
RINAATMLGQSKNAFQAEIDAACELIDFFRFNVHFMQQIYQQQPESLPGMWNRLEHRPLE
GFVFALTPFNFTSIAANLPASVAIMGNVVVWKPANTQIYSAQVLMELFKEAGVPDGVINL
VYVDGPTAGEVIFKHRDFAGIHFTGSTGVFQNIWKTIGENISSYKSYPRIVGETGGKDFI
LAHPSAHAKAVAVGISRGAFEYQGQKCSAASRVYLPSNLADEILGYVKEDLASFRMGDVE
DFSNFINAVIDEKSFDKLAKYIDGAKADPNAEIVAGGGYDKSKGYFIEPTVIVTKDPKYV
TMCEELFGPVVTVHIYDADKFDEVLELVDTTSPYALTGAIFSQDRYAIDHASKKLVHAAG
NFYINDKPTGAVVGQQPFGGARASGTNDKAGSMLNLLRWVSPRAIKETFVPVTDYRYPFL
GSEPKEDLNRDKGL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccaacggctttttcaacgtcccgaccccgatcaacgagcccgtaaaaggctacgcg
cccaactcgccggagcgtattgagttgctcaagactctcaaggagctcaagcagcagcag
cgcgacattccaatgcacatcggcggccaggaaatccgtaccggcaggaagcagaacatc
accccaccccacgaccaccagcacgtgctgggccagttccacgaaggcgacgcctcgcac
gtagcgcaggccatcgacgccgctctggccgcccgcccgctgtgggccgaaatgccctgg
gagcaccgcgccgccatcttcctgaaggccgccgacctgctggccggcccctaccgggcg
cgcatcaacgcggccaccatgctgggccagagcaaaaacgccttccaggccgaaatcgac
gcggcctgcgagctgatcgacttcttccggttcaacgtgcacttcatgcagcagatctac
cagcagcagcccgagagcctgcccggtatgtggaaccgcctggagcatcgcccgctggaa
ggcttcgtgtttgccctcacgcccttcaatttcacctccattgccgccaacctgcccgcc
tcggtggccataatgggcaacgtggtggtgtggaagcccgccaacacccagatctactcg
gcccaggtgctgatggagctgttcaaggaagccggcgtgcccgacggcgttatcaacctg
gtgtacgtggacggccccaccgctggcgaggtcatcttcaagcaccgcgactttgccggc
atccactttaccggctccaccggcgtgttccagaacatctggaaaaccatcggcgagaac
atcagcagctacaagagctacccgcgcatcgtgggcgaaaccggcggcaaggattttatc
ctggcccacccctcggcgcacgccaaggccgtggccgtgggcatcagccggggcgcgttt
gagtaccagggccagaagtgctcggccgcctcgcgggtgtacctgcccagcaacctggcc
gacgaaattctgggctacgtgaaggaagacctggcctcgttccggatgggcgacgtggag
gacttctccaacttcatcaacgccgttatcgacgagaaatccttcgataagctggccaag
tacatcgacggcgccaaggccgacccgaacgccgaaatcgtggccggtggcggttacgac
aagtcgaaaggctacttcatcgagcccaccgtcatcgtaaccaaggaccccaagtacgtg
acgatgtgcgaggagctgttcggccccgtggtgacagtgcacatctacgacgccgacaag
ttcgacgaagtattggagctggtggatacgacctcgccctacgccctcaccggcgccatc
ttctcgcaggaccgctacgccatcgaccacgcctcgaagaagctggtgcacgccgccggc
aacttctacattaacgacaagcccaccggcgcggtagtcggccagcagcccttcggcggc
gcccgcgcctccggcaccaacgacaaggccggctccatgctgaacctgctccgctgggtg
tcgccgcgcgccatcaaggaaaccttcgtgcccgtcacggattaccgctaccccttcctg
ggctccgagcccaaggaggacctgaaccgcgacaaggggttgtag

DBGET integrated database retrieval system