KEGG   Hymenobacter sp. APR13: N008_06375Help
Entry
N008_06375        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    N008_06375
Enzymes [BR:hym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     N008_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR Sortilin-Vps10 DUF4185
Motif
Other DBs
NCBI-ProteinID: AII51607
UniProt: A0A076HSK4
Position
complement(1487710..1489251)
Genome map
AA seq 513 aa AA seqDB search
MKSILSCALVLLGTLPCAAQTPAPDPYRPVYHFTAPKNWINDANGLIYSNGQYQLFYQYN
PYSADPGHLSWGHATSPDLLRWTPQPVALTEYKNPDGSNTMIFSGSAVADKDNTSGLFPK
GQTDGLVAFYTGHVERPGVVLRQHQNIAYSLDHGQTWQRYAQNPVLDIDSKEFRDPKVFW
YAPQQKWVMATVKADRQEVYLYESKNLKNWTFLSRWGRAGNTVREWECPDLFELPVPGGG
TKWVLLISAGNPTEQFRGQQYFLGSFDGRKFTPDQPYEEPSYLDFGKDFFAGVTFNDAPG
NRRILVGWTNDWAYARDVPTGTEWRGNFAVPRELSLRRTAQGLALVQQPVPELRKIGKEA
LALKNQALKPGAAAYELPFKGESYDLELTLKPGAAKVLTLNVLQSETERTTLRYDVARQE
LTLDRTQSGNVAFHPLFASSLESARVPLRDGQLQLRLLVDRSVVEVFAQDGEVTLTDLVF
PRQHAGRITLSTDGGPAQITALRLTDLRQPLVP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccattctctcctgcgctctggttctgctcggcacgcttccgtgtgcggcccaa
acccctgcgcccgacccttaccggccggtgtaccacttcacggccccaaaaaactggatc
aatgatgccaatggcctgatctacagcaacgggcagtaccagctattctaccagtacaac
ccctacagcgccgaccccggccacctcagctggggtcacgccaccagccccgacctgctg
cgctggacgccccagcccgtggccctcaccgagtataagaaccccgacggcagcaacacc
atgattttctcgggcagcgccgtagccgacaaggacaacacctccggcctgttcccgaaa
ggccagaccgacggcttggtggccttctacaccggccacgtggagcggccgggcgtggtg
ctacgccagcaccagaacatagcctacagcctcgaccacggccagacctggcagcgctac
gcccagaaccccgtgctcgatatcgacagcaaggagttccgcgaccccaaggtgttctgg
tatgcgccgcagcagaaatgggtgatggccaccgtgaaggccgaccgccaggaggtgtac
ctctacgagtcgaaaaacctgaagaactggaccttcctgagccgctggggccgggccggc
aatacggtgcgcgagtgggagtgccccgacctgtttgagctgcccgtgcccggtggcggc
accaagtgggtgctgctgatttcggccggcaaccccaccgagcagttccggggccagcag
tatttcctgggcagcttcgatggccggaaattcacgcccgaccagccctacgaggagcct
agctacctcgatttcggcaaggatttctttgccggcgtgaccttcaacgacgcgcccggc
aaccgccgcattctggtgggctggaccaacgactgggcctacgcccgcgacgtgcctacc
ggcaccgagtggcgcggcaactttgcggtgccccgtgagctgagcttgcgccgtaccgcc
cagggcctggcgctggtgcagcagccggtgccggagctgcgcaaaatcggcaaggaagcc
ctggccctgaaaaaccaggccctcaagcccggcgcggccgcctacgagctgccgttcaag
ggcgagtcctacgacctggagctgacgctgaagcccggtgcggccaaggtgctgacccta
aatgtactgcaaagtgaaaccgagcgcactacgcttcgctacgacgtagcgcgccaggaa
ctgacgctggaccgcacccaatcgggcaatgttgcctttcaccccttgttcgccagcagc
cttgaatcggcgcgcgtgcccctgcgcgacgggcagctgcaactgcggctgctggtggac
aggtcggtggtggaggtatttgcccaggatggcgaagtcacgctcaccgacctggtgttt
ccgcgccagcacgccggccgcatcacgctcagcaccgacggtggcccggctcagataacc
gccctgcgcctcaccgacctccgccagccccttgtgccttag

DBGET integrated database retrieval system