KEGG   Hymenobacter sp. APR13: N008_13565Help
Entry
N008_13565        CDS       T03213                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00072  Synthesis and degradation of ketone bodies
hym00280  Valine, leucine and isoleucine degradation
hym00650  Butanoate metabolism
hym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N008_13565
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    N008_13565
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N008_13565
Enzymes [BR:hym01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     N008_13565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AII53000
UniProt: A0A076HTA4
Position
complement(3192893..3193549)
Genome map
AA seq 218 aa AA seqDB search
MLDKHGIARRIAQEVQNNSYVNLGIGIPTLVANYIPEGINVELQSENGLLGMGPFPTEDQ
VDPDLINAGKQTVTTLPGSSIFSSADSFGMIRGEHVDLTILGAMEVSENGDIANWKIPGK
MVKGMGGAMDLVASAKNIIVAMQHVARDGSSKLLPACTLPITGLRCVKKIVTELAVIDVT
PDGFVLRERAPGVTVEQIQAATAGKLVVRGEIPEMTGV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaacacggcattgcccggcgcattgcgcaggaagtccagaacaactcctac
gtcaacctcggcatcggcatcccgacgctggtggccaactacatcccggaaggcatcaac
gtggagctgcagagcgaaaacggcctgctgggcatgggccccttccccaccgaagaccag
gtagaccccgacctcatcaacgccggcaagcaaaccgtcaccaccctgcccggttccagc
atcttcagctccgccgactcgttcggaatgattcggggcgagcacgtggacctgaccatt
ctgggcgccatggaggtttccgagaacggcgacattgccaactggaagattccgggcaag
atggtgaagggcatgggcggggccatggacctggtggcctcggccaaaaacatcatcgtg
gccatgcagcacgtggcccgcgacggcagcagcaagctgctgcccgcctgcaccctgccc
atcaccggcctgcgttgcgtgaagaaaatcgtaacggagctggccgtcatcgacgtgacg
cccgacggctttgtgctgcgcgagcgggcccccggcgtgaccgtggagcagattcaggcc
gctaccgccggcaagctggtcgtgcgcggcgaaatcccggaaatgactggggtgtga

DBGET integrated database retrieval system