KEGG   Hymenobacter sp. APR13: N008_13700Help
Entry
N008_13700        CDS       T03213                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
hym  Hymenobacter sp. APR13
Brite
KEGG Orthology (KO) [BR:hym00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    N008_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AII53024
UniProt: A0A076HZA2
Position
complement(3223186..3223572)
Genome map
AA seq 128 aa AA seqDB search
MNTTTTQGVTVSVTTNYLPDYSSPSQEHYVFAYKIDIRNNSEYTVKLLRRHWYIYDANGV
VREVEGDGVVGQQPVLEPGEAHQYVSGCNLKSGLGKMRGTYDMERLADGSTFEVEIPEFT
LVVPYRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaccactacgcagggcgtcaccgtgagcgtcacgaccaattacctgcccgac
tactccagccccagccaggagcattacgtgtttgcctacaagattgatattcgcaacaac
agtgagtacaccgtgaagctgctgcgccgccactggtatatctacgacgccaacggcgtg
gtgcgcgaagtggagggcgacggcgtggtaggccagcagcccgtgctggagcccggcgag
gcccaccagtacgtatcgggctgcaacctcaagtcggggctgggcaagatgcgcggcacc
tacgacatggagcggctggccgacggcagcaccttcgaggtggaaatccccgaattcacg
cttgtggtgccgtaccgcctgaactag

DBGET integrated database retrieval system