KEGG   Hymenobacter sp. APR13: N008_14405Help
Entry
N008_14405        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00500  Starch and sucrose metabolism
hym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N008_14405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hym01003]
    N008_14405
Enzymes [BR:hym01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     N008_14405
Glycosyltransferases [BR:hym01003]
 Polysaccharide
  Storage polysaccharide
   N008_14405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_5 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4 PNK3P
Motif
Other DBs
NCBI-ProteinID: AII53161
UniProt: A0A076HU93
Position
complement(3391876..3393714)
Genome map
AA seq 612 aa AA seqDB search
MQVPAAAPAPLAPDSLLVEVAWEVCNQVGGIYTVIRSKVPATVQGWEDRYCLLGPYFAQQ
AQSEFEPYDDYQLSTLSDPFAGAVREMRKLGYDVHLGVWLVTGRPRVVLINPYQAYPQLG
QIKGDLWHHHGIPTPDHDDLLHQVEAFGHLAKIYLQTLAAEVVPPQRVVAHFHEWMTGVA
IPALRREQTPLHIVFTTHATLLGRYLAMNDPNFYEHLMLVDWEAEAKRFNIETAVRIERA
AAHGSHVFTTVSELTVRECIYLLDRIPDAVLPNGLNIERFVALHEFQNLHQQYKAKIHEF
VMAHFFQSYSFDLDKTLYLFTSGRYEYHNKGFDLTLEALARLNYRLQQSGLEGNVVMFFI
TKRPFHSINPQVLQSRAILEEVQETCEAIERQVGERLFYAAAASQDHRLPDLSSMVDDYW
KLRYRRTLQSWKTPNLPPVITHNLVDDANDDILNFVRGANLVNNRHDRVKIVYHPDFVSP
TSPLFGMEYGQFVRGCHLGIFPSYYEPWGYTPLECVARGVPAITSDLSGFGDYVMQHVPQ
HEDKGIFVVQRQEKSFDESAEELTEMLWQFVLLNRRERIMQRNNVESNAEIFDWKNLRVY
YDRAYTLALERQ
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcccgccgctgcccccgccccccttgcccctgattcgttactggtagaagtg
gcctgggaagtctgcaaccaagtgggtggcatctacaccgtaatccgcagcaaggtgccc
gccaccgtgcagggctgggaagaccgctattgcctgctgggaccttacttcgcgcagcag
gcccaaagcgagtttgagccctacgacgactaccagctttccaccctcagcgacccgttt
gccggggccgtgcgcgaaatgcgcaagctcggctacgacgtgcacctgggcgtgtggctc
gtgacgggccggccccgggtggtgctcatcaacccctaccaggcctacccgcagctgggc
cagatcaagggcgacctgtggcaccaccacggcatcccgacgcccgaccacgacgacctg
ctgcaccaggtggaagccttcgggcatctagccaaaatctatctgcagacgctggctgcc
gaggtggtgccgccgcagcgcgtggtggcccatttccacgagtggatgacgggcgtggcc
attccggcgctgcgccgcgagcagacgccgctgcacatcgtgtttaccacccacgccacg
ctgctgggccgctacctggccatgaacgaccccaatttctacgagcacctgatgctggta
gactgggaagccgaggccaagcgcttcaacatcgaaacggccgtgcgcattgagcgcgcc
gccgcccacggcagccacgtgttcacgaccgtgagcgagttgacggtgcgcgagtgtatt
tacctgctggataggattccggacgcggtgctgcccaacggcctcaacatcgagcggttt
gtggccttgcacgagttccagaacctgcaccagcaatacaaggccaagattcacgagttc
gtgatggcgcacttcttccagagctactcgtttgatctggacaagacgctgtacctgttc
acgagtggccgctacgagtaccacaacaaaggcttcgacctgacgctggaagcgctggcc
cgcctcaactaccgcctgcagcaaagcgggctggaaggcaacgtggtgatgttctttatc
acgaagcgcccgttccacagcatcaacccacaggtgctgcagagccgcgccattctggaa
gaggtgcaggaaacctgcgaggccattgagcggcaggtgggcgagcggctgttctacgcc
gccgccgccagccaggaccaccgcctgcccgacctgagcagcatggtcgacgattactgg
aagctgcgctaccgccgcacgctacaaagctggaaaacccccaacctgcccccggtcatc
acccacaacctcgtcgatgacgccaacgacgacatcctcaattttgtgcgcggcgccaac
ctagtgaacaaccgccacgaccgggtgaaaatcgtgtaccatcctgatttcgtgtcgccc
acgtcgccgctgtttggcatggagtacgggcagtttgtgcgaggttgccacctgggcatc
ttccccagctactacgagccctggggctacaccccgctcgagtgcgtggcgcgcggcgta
ccggccatcacctccgacctgtctggcttcggcgactacgtgatgcagcacgtgccccag
cacgaagacaaaggcatttttgtagtgcagcgccaggaaaagagcttcgacgagtcggcc
gaggagctgaccgagatgctgtggcagtttgtgctactcaaccgccgcgagcgaatcatg
cagcgcaacaacgtggaaagcaacgccgaaatcttcgactggaaaaacctgcgcgtgtac
tacgaccgcgcctacacgctggccctagagcggcaatag

DBGET integrated database retrieval system