KEGG   Hydrogenimonas sp. MAG: NNO_1814Help
Entry
NNO_1814          CDS       T05789                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hyo  Hydrogenimonas sp. MAG
Pathway
hyo00540  Lipopolysaccharide biosynthesis
hyo01100  Metabolic pathways
Module
hyo_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NNO_1814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hyo01005]
    NNO_1814
Enzymes [BR:hyo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     NNO_1814
Lipopolysaccharide biosynthesis proteins [BR:hyo01005]
 Unusual sugar
  NNO_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind adh_short Ldh_1_N KR
Motif
Other DBs
NCBI-ProteinID: BBG66517
UniProt: A0A3G9HKH9
Position
1848151..1849146
Genome map
AA seq 331 aa AA seqDB search
MDFNGKSILITGGAGFIGSNLAHRFQESFPGAEVVVFDLFRTGETFDNGNLKSFGHYKNL
KGFKGEIISGDITKKEDLERLEDFSFDYIFHEAAISDTTVYDQKIMIDTNLNAFKDLLKM
AKKMDAAIIYASSGATYGNAPAPQTVGREDPANIYGFSKLAMDNLAYEWMKKSDLPIVGL
RYFNVYGPREFFKNRTASMVLQFGHQILAGKNPKLFEGSDTILRDFIYIDDVIQANIKAC
NPKRSGVYNVGTGKARSFQDIVDILQKELGTSLECEYIPNPYIGQYQFFTQADIEPTREF
LGYEPEVTLEEGIRRYVPEIVRLFKEEVDGR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggattttaacggcaaaagcatactcataaccggaggggccggtttcataggctccaat
ctggcgcaccgttttcaggagagtttccccggggccgaggtggtggttttcgacctattc
cgcaccggcgaaaccttcgacaacggaaacctcaagagcttcggccactacaaaaacctc
aaaggcttcaagggtgagataatttccggagacataaccaaaaaagaggatctcgagcgc
ctcgaagatttcagtttcgactacatattccacgaggcggcgataagcgacaccacggtt
tacgaccagaagataatgatagataccaacctgaacgccttcaaggatcttctgaagatg
gcgaaaaagatggatgcggcgataatctacgcaagctccggcgccacatacggaaacgca
cccgcaccgcagacggtcgggcgtgaagacccggcgaacatctacggtttcagcaagctc
gccatggacaacctcgcctacgagtggatgaaaaagagcgacctgccgatagtgggactc
cgctacttcaacgtctacggcccgagggagtttttcaaaaacagaaccgcctcgatggta
ctgcagttcggccaccagatactcgccggcaaaaaccccaaactcttcgaaggctccgac
acgattcttcgcgacttcatatacatagacgacgtaatacaggcaaacataaaagcgtgc
aacccaaaaagaagcggcgtctacaacgtaggaaccggaaaagcgagaagcttccaggat
atcgtcgacatactccaaaaagagctcggcactagtctggagtgcgaatatattcccaac
ccctacatagggcagtaccagttcttcacccaggcggacatagagccgacgagagagttt
ttggggtatgagcccgaagtgacgctcgaagagggaatccggcggtatgttccggagatt
gttcggcttttcaaggaagaagtcgatggtcgatag

DBGET integrated database retrieval system