KEGG   Hymenobacter sp. PAMC 26554: A0257_07805Help
Entry
A0257_07805       CDS       T04376                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
hyp  Hymenobacter sp. PAMC 26554
Pathway
hyp00250  Alanine, aspartate and glutamate metabolism
hyp00330  Arginine and proline metabolism
hyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A0257_07805
   00330 Arginine and proline metabolism
    A0257_07805
Enzymes [BR:hyp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A0257_07805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMR27023
UniProt: A0A142HDR5
Position
1844698..1846362
Genome map
AA seq 554 aa AA seqDB search
MSNAFFRVPTPINEPVKGYAPGAPERIELVKELKRIKQVEGDIPMHIGGQEVRTGRTLPL
APPHDHQHVLAHFHEGDAGHVTQAIDAALAARPAWAGLPWEERAAVFLKAAELLAGPYRA
RINAATMLGQSKNAFQAEIDAACELIDFLRFNVYFAQEIYRQQPESSPGMWNRLEHRPLE
GFVFALTPFNFTSIAANLPMAAALMGNVVVWKPAYPQIYSAQVLMELFIEAGVPAGVINL
IYVDGPVAGDVIFKHPDFAGIHFTGSTKVFQTIWQEIGQNIHRYKSYPRIVGETGGKDFI
VAHPSAHAKAVATAISRGAFEYQGQKCSAASRVYLPSNLADEILGYVKQDVESMKMGDVE
DFTNFINAVITEASFDKLAKFIDEAKASPDAEIVVGGHHDKSKGYFVQPTVIRAKDPKYV
TMCEELFGPVVTVYVYDADQFEQTLELVDSTSPYALTGAIFSQDRYTIDLATRKLVNAAG
NFYINDKPTGAVVGQQPFGGARASGTNDKAGSLLNLQRWVSPRAIKETFNPPTAYPYPFM
GAEPKENLSLDKGL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcctttttccgcgtccctacccccatcaatgagcccgtgaagggctacgcg
cccggcgcgcccgagcgcatcgagctggtgaaagagctcaagcgcatcaagcaggtggag
ggcgatattccgatgcacatcggtggccaggaagtgcgcaccggccgcacgctgcctctg
gccccgccccacgaccaccagcatgtactggcccactttcacgagggcgatgcgggccac
gtgacgcaggccatcgacgcggcgctggcggcccgccctgcctgggccggtctgccctgg
gaggagcgcgccgccgttttcctgaaggccgccgagctgctggccggcccttaccgcgcc
cgcatcaacgcggctactatgttggggcagagcaagaatgcgtttcaggcggagattgac
gcggcgtgcgagttgattgattttctgcggtttaacgtgtattttgcgcaggaaatttac
cgccagcagcccgagtcgtcgcccggcatgtggaaccgcctggagcaccgcccgctcgaa
ggcttcgtgttcgcgctcacgccgttcaacttcacgtccattgccgccaacctgccgatg
gcggccgcgctcatgggcaacgtggtggtgtggaagcccgcctacccccagatttattcg
gcgcaggtgctgatggaattgttcatcgaagcgggcgtgccggcgggcgtcatcaacctg
atttacgtggatggaccggtggccggcgacgtgatttttaagcaccccgatttcgcgggc
attcacttcacgggctcgaccaaggttttccagaccatctggcaggagattgggcagaat
attcaccgctataagtcctacccccgcatagtgggcgaaaccggcggcaaggactttatt
gtggcgcacccgtcggcccacgccaaggcggtggccacggccatctcgcgcggcgcgttt
gagtaccagggtcagaagtgctcggccgcttcgcgcgtctatctgccttccaacctggcc
gatgagattctgggctacgtgaagcaggacgtggaatctatgaaaatgggtgacgtggag
gactttaccaactttatcaacgccgtgattaccgaagccagctttgataaactggccaag
tttattgatgaggccaaggccagcccggacgccgaaatcgtggtgggcggccaccacgat
aagtcgaaaggctacttcgtgcagccgaccgtgattcgggccaaagacccgaaatacgtg
acgatgtgcgaggagctattcggacctgtggtgacggtatatgtttatgacgctgaccaa
tttgaacagacactagaactggtagattcgacctcaccctacgccctgaccggcgctatt
ttctcgcaggaccgctacaccatcgacctggctaccaggaaattggtgaacgcggccggc
aacttctacatcaacgacaagccgaccggcgcggtggtgggccagcagccgtttggcggg
gctcgcgcctcgggcaccaatgataaagccggctcgctgctcaatttgcagcgctgggtg
tcgccccgcgccattaaggagacgttcaatccgcccacggcgtatccctaccccttcatg
ggggccgaaccgaaggagaatttgagcctggacaaaggtctttaa

DBGET integrated database retrieval system