KEGG   Hymenobacter sp. PAMC 26554: A0257_18450Help
Entry
A0257_18450       CDS       T04376                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hyp  Hymenobacter sp. PAMC 26554
Pathway
hyp00020  Citrate cycle (TCA cycle)
hyp00480  Glutathione metabolism
hyp01100  Metabolic pathways
hyp01110  Biosynthesis of secondary metabolites
hyp01120  Microbial metabolism in diverse environments
hyp01130  Biosynthesis of antibiotics
hyp01200  Carbon metabolism
hyp01210  2-Oxocarboxylic acid metabolism
hyp01230  Biosynthesis of amino acids
Module
hyp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0257_18450
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0257_18450
Enzymes [BR:hyp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A0257_18450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AMR28882
UniProt: A0A142HJ24
Position
4342361..4343593
Genome map
AA seq 410 aa AA seqDB search
MTKINVANPVVELDGDEMTRIIWKFIKDKLILPYLELDIKYYDLGIEHRDETNDQVTIDS
ANAIKQYGVGIKCATITPDEERVKEFGLKQMWKSPNGTIRNILDGTVFREPIVMRNVPRL
VPNWTAPICIGRHAFGDQYRATDFLTKGKGKLTITFQPEDGGETQSFEVFNFKSDGVALA
MYNTDESIRGFAHACFNQALMKGWPLYLSTKNTILKKYDGRFKDIFQEIYEQDYTEKFKA
AGITYEHRLIDDMVASALKWHGNFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLVTPDGG
TMEAEAAHGTVTRHYRDHQNGKPTSTNPIASIFAWTRGLEFRGILDKNQELIDFCKALEA
VCIETVESGKMTKDLAVCIHGNKVQHGRDYLYTEEFLEALDENLKKKLSK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatcaacgtagcgaaccccgtagtagagctcgacggcgacgagatgacgcgc
atcatctggaaatttatcaaagacaagctcattctgccttatctggaactcgacatcaag
tactatgacctgggtatcgagcaccgcgacgaaaccaacgaccaggtaaccatcgactcg
gccaacgccatcaagcaatacggcgtgggcatcaagtgcgccaccatcacccccgacgag
gagcgcgtgaaggagttcggtctcaagcagatgtggaagtcgcccaacggcaccatccgc
aatattctggatggcaccgtgttccgcgagccgattgtgatgcgcaacgtgccgcgcctg
gtgcccaactggacggccccgatttgtattggccgccacgccttcggcgaccagtaccgc
gccaccgacttcctgaccaagggcaagggtaagctcaccatcactttccagcccgaagac
ggcggcgaaacccagtcgtttgaggtattcaacttcaaaagtgacggcgtggcgctggcc
atgtacaacaccgacgagtcgattcgcggcttcgcgcacgcctgcttcaaccaggccctg
atgaaaggctggccgctgtacctgagcactaagaacacgattctcaagaagtacgatggc
cgcttcaaggatattttccaggagatttacgagcaggactacacggagaaattcaaggcc
gctggcatcacctacgagcaccgcctcatcgacgacatggtggcctcggccctgaagtgg
cacggcaacttcgtgtgggcctgcaaaaactacgacggcgacgtgcagagcgacaccgtg
gcccagggcttcggctcgctcggcctgatgacctccgtgctggtgacgcccgacggcggc
acgatggaggccgaagccgcccacggcaccgtgacgcgccactaccgcgaccaccagaac
ggcaagcccactagcaccaaccccatcgccagcatcttcgcctggacgcgcggcctcgaa
tttcggggcattctggataagaaccaggaactcatcgacttctgcaaagccctcgaagcc
gtgtgcatcgaaaccgtggaaagcggcaaaatgaccaaggacctcgccgtgtgcattcac
ggcaacaaggtgcagcacggccgcgactacctctatacggaggaatttttggaggcgctg
gatgagaatttgaagaaaaagctgagtaagtaa

DBGET integrated database retrieval system