KEGG   Hydrogenophaga sp. RAC07: BSY239_1285Help
Entry
BSY239_1285       CDS       T04455                                 

Gene name
bchB
Definition
(GenBank) light-independent protochlorophyllide reductase, B subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00860  Porphyrin and chlorophyll metabolism
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSY239_1285 (bchB)
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     BSY239_1285 (bchB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: AOF86560
UniProt: A0A1B3M0C6
Position
1362537..1364105
Genome map
AA seq 522 aa AA seqDB search
MQLTLWTYEGPPHVGAMRIATAMKDVHYVLHAPQGDTYADLLFTMIERNAKRPPVTYTTF
QARDLGGDTAELFKNAAREAYERFKPQAMMVGSSCTAELIQDDPGGLCKALDLPVPVVAL
ELPSYQRKENWGASETFYQMVRNLADTSLKRAPRDAGQRARCNILGPAALGFRHRDDLRE
ISGLLREMGVDINVTAPLGASPADMARLGDADFNVVLYPEIANVAAGWLKRTFGQPSTRT
VPIGSGATRDFIHEVAELAGVDPAAVLANAEARAPWYAKSVDSTYLTSKRVFVFGDATHV
VAAARIAAQEMGFTVVGLGTYSREFAREVREAAALYGVEALISDDYLEVEARIAELQPEL
VLGSQMERHIAKRLGVPCAVISAPVHVQDFPARYSPQMGFEGANVLFDTWVHPLMMGLEE
HLIGMFRGDAEFHEDAAPSHLGGAMTPKAVVAPVAPVEQAAANETLTPQEATWGLDAEKE
LRKIPFFVRGKARRNTERFAIDRGVSLITVETLYDAKAHYGR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcacgctctggacctacgaaggaccgccccatgtgggcgcgatgcgcatcgcc
accgcgatgaaggacgtgcactacgtgttgcacgccccgcagggcgacacctacgcggat
ctgctgttcaccatgatcgagcgcaacgccaagcgcccgcccgtgacctacaccactttc
caggcgcgcgacctgggtggcgacaccgccgagctgttcaagaacgcagcgcgcgaagcc
tacgaacgcttcaagccgcaggccatgatggtcggctcctcgtgcaccgccgagctgatc
caggacgacccgggtggcctgtgcaaggcgctcgatctgccggtgccggtggtggcgctg
gaactgccgtcttaccagcgcaaggaaaactggggcgcgtccgagaccttctatcagatg
gtgcgcaacctggccgacaccagcctcaagcgcgccccgcgagacgccggccagcgcgcc
cgctgcaacatcctcggccccgccgcgctgggctttcgccaccgcgacgacctgcgcgaa
atctccggcctgctgcgtgagatgggcgtggacatcaacgtgaccgcgcccctgggcgca
tcgccagccgacatggcgcgcctgggcgatgccgacttcaacgtggtgctctaccccgag
atcgccaacgtggccgccggctggctcaagcgcacattcggccagccgtccacccgcacc
gtgccgatcggctcgggcgccacgcgcgacttcatccacgaggtggccgagctggccggt
gtggaccccgccgcggtgttggccaacgccgaagcccgcgcgccctggtacgccaagtcg
gtcgactccacctacctcacgagcaaacgcgtcttcgtgttcggcgacgccacccacgtg
gtggccgctgcgcgcatcgccgcgcaagagatgggcttcaccgtggtcggtctgggcacc
tacagccgggagttcgcccgcgaggtgcgcgaggccgctgcgctctacggtgtggaagcg
ctgatcagcgacgactacctggaagtggaggcccgcatcgccgagctgcagcccgagctg
gtgctgggctcgcagatggagcgccacatcgccaagcgcctgggcgtgccttgcgcggtg
atctcggcgcccgtgcacgtgcaggactttcccgcgcgctactcgccgcagatgggtttt
gaaggcgccaacgtgctgttcgacacctgggtgcacccgctgatgatgggcctggaagag
cacctgatcggcatgttccgcggcgacgccgagtttcacgaagacgccgcgccctcgcac
ctgggcggtgcgatgacgcccaaggccgtggtggcaccggtcgcacctgtggagcaggcg
gccgcgaacgagaccctcacgccgcaagaggccacctggggcctcgacgccgaaaaagaa
ctgcgaaagatccccttcttcgttcgcggaaaagccaggcgcaacaccgagcgttttgcc
atcgaccgaggggtgtccctgatcaccgtggagacgctgtatgacgccaaagctcactat
gggcgctaa

DBGET integrated database retrieval system