KEGG   Hydrogenophaga sp. RAC07: BSY239_1437Help
Entry
BSY239_1437       CDS       T04455                                 

Definition
(GenBank) copper-translocating P-type ATPase
  KO
K01533  P-type Cu2+ transporter [EC:7.2.2.9]
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY239_1437
Enzymes [BR:hyr01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.9  P-type Cu2+ transporter
     BSY239_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA HAD Hydrolase_3 DUF3413
Motif
Other DBs
NCBI-ProteinID: AOF87183
UniProt: A0A1B3M257
Position
1518543..1520936
Genome map
AA seq 797 aa AA seqDB search
MKQDPDYAQAMNQAVATLPVRPPLADPDSVPSAPSWLGDHRGPLTVTDNFAVLDDPVEQE
TFTQRIEQPDGDLAESVLMVQGMYCAACADTVESALQGLPGVQQARVHAATRRLTLRWDP
SATRMSSLAQVVGERGYRLLPMQQALGISERLRETRQGLWRLFVAGFCMMQVMMYAWPAY
VTEPGEIPADIDQLLRWASWVISLPVVFFASGPFFESAWRDLKHGRVGMDTPVSIGILVT
FLVSSAATFDPTGPWGAEVWFDSLTMFVFFLLGGRYLEFKARDRTAGALDSLMNRLPEVC
ERETAQGLETVSVRRLVVGDVVRVQAGQAFAADGELLSERATVDEALLTGESRPVTREQG
QGVVAGSFNLGGPVRMRVMQVGRDTRFAQIVKLMEQASTEKPRLAILADRIAAPFLLLVL
LAAAVAGVYWWQIDHTRALAVAVAVLIVTCPCALSLATPAAMLSSAGALARRGVLVRRLQ
AFEVLAGINAVVFDKTGTLTHDRLVLREVATRAGVGRDRALALAGALAAGSLHPVSRALA
QHSTGQQLVDVREVAGQGMQARLPDGTGVRLGSAAFCGAPLADAIEDAPRAHLSDDHGWM
ASFTLEEGLRDDAREAVLALRALGVRTWLLSGDRASAAEAVGQAVGVDHVIAGATPEQKL
DEVTRLQAQGLTIAMVGDGLNDGPVLARADTSFALGHAAPLAQAQSDYVIQGGQVMDVVH
TLTQARATLRVVRQNLIWAAAYNVVAVPLALVGWMPPWLAGLGMAGSSLLVIGNALRLAG
KTPASSSINPVSAPASA
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagaccccgattacgctcaagccatgaaccaggccgttgccacgctcccggtg
cggcccccgcttgccgaccccgattccgtaccgtcggcccccagctggctgggcgaccac
cggggcccgctcaccgtcaccgacaactttgcggtgctcgacgatccggtggagcaggag
accttcacccagcgcattgaacagcccgatggtgatctcgccgaatcggtattgatggtg
cagggcatgtattgcgccgcctgcgccgacacggtggagtcggccctgcaaggcctgccc
ggcgtgcagcaggcccgggtgcacgcggccacacgccggctgacgctgcgctgggacccg
tcagccacgcgcatgtcgagcctggcgcaggtggtgggcgagcgtggctaccggctgctg
cccatgcaacaggcgctgggcatcagcgagcgactgcgcgaaacacggcagggtttgtgg
cgcctgtttgtcgcgggcttctgcatgatgcaggtgatgatgtacgcgtggccggcgtat
gtgaccgagccgggcgagatcccggccgacatcgaccagttgctgcgctgggccagctgg
gtgatcagcctgccggtggtgttttttgccagcggcccctttttcgagagtgcctggcgc
gacctcaagcacggccgtgtgggcatggacacgccggtgtccatcggcatcctcgtcact
ttcctggtgagctcggccgcgaccttcgaccccacgggaccctggggtgccgaggtctgg
ttcgactcgttgaccatgttcgtgtttttcctgctcggcgggcgctacctcgagttcaag
gcgcgcgaccgcacggcaggcgcgctcgacagtctgatgaaccggctccccgaggtctgc
gaacgcgagaccgcccagggcctggagacggtgtccgtgcgccggctggtggtgggcgac
gtggttcgggtgcaggcgggccaggcctttgcggccgacggtgaactgctgagcgagcgc
gccacggtggacgaggcgctgctcaccggcgaatcgcgcccggtcacacgcgagcaaggg
cagggcgtggtggcgggcagcttcaatctgggtggtcccgtgcgcatgcgcgtgatgcag
gtggggcgcgacacgcgctttgcccagatcgtcaaactgatggaacaggcttccaccgag
aagccccgcctggccatcctggccgaccggatcgcggcgccgtttctgttgctggtgttg
ctggcagcggcggtggccggggtgtactggtggcagatcgaccacacgcgcgcactcgca
gtggcggtggccgtgctcatcgtcacctgcccgtgtgcgctctcgctggccacgccggcg
gccatgctcagttcggccggggcgctggcgcgccgcggggttctggtgcgacggctgcag
gccttcgaggtgctggcgggcatcaacgcggtggtgttcgacaagaccggcacgctcacc
cacgaccgtctggtgttgcgcgaagtcgccacgcgcgccggggtgggccgcgatcgtgcg
ctggccctggccggcgcactggccgccggctcgctccacccggtgtcccgtgcgctggcg
cagcattccacagggcagcagctggtggatgtgcgcgaggtggcggggcagggcatgcag
gcacgcctgcccgacggcaccggggtgcggctgggctcggccgcgttctgcggggcgccc
ctggccgatgcgattgaagacgcgccgcgcgcgcacctgagcgacgaccatggctggatg
gccagcttcacgctggaagaaggcctgcgcgacgacgcgcgcgaggcggtgcttgcgctg
cgtgcgctgggcgtgcgcacctggctgctctcgggtgacagggcaagcgccgccgaagcc
gtggggcaggcggtgggggtggaccacgtgatcgccggtgccacgcccgaacagaagctg
gatgaggtcacccgcttgcaggcgcagggtctcaccatcgcgatggtgggcgacgggctc
aacgacggaccggtgctcgcgcgcgccgacacctcgtttgcgctcggccatgccgcgcca
ctggcgcaggcccagtccgactacgtgatccagggcgggcaggtcatggatgtggtgcac
acactcacccaggcccgggccacgctgcgtgtggtgcggcagaacctcatctgggcggcc
gcctacaacgtggtcgccgtgccgctggcgctggtggggtggatgccgccctggctggcc
ggcctgggcatggcgggcagctcgctgctggtgatcggcaacgccttgcgcctggcgggg
aagaccccagcctcctcgtcgatcaatccggtttctgcgcccgcatcggcgtag

DBGET integrated database retrieval system