KEGG   Hydrogenophaga sp. RAC07: BSY239_1677Help
Entry
BSY239_1677       CDS       T04455                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00071  Fatty acid degradation
hyr00072  Synthesis and degradation of ketone bodies
hyr00280  Valine, leucine and isoleucine degradation
hyr00310  Lysine degradation
hyr00362  Benzoate degradation
hyr00380  Tryptophan metabolism
hyr00620  Pyruvate metabolism
hyr00630  Glyoxylate and dicarboxylate metabolism
hyr00640  Propanoate metabolism
hyr00650  Butanoate metabolism
hyr00900  Terpenoid backbone biosynthesis
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
hyr01120  Microbial metabolism in diverse environments
hyr01130  Biosynthesis of antibiotics
hyr01200  Carbon metabolism
hyr01212  Fatty acid metabolism
hyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY239_1677
   00630 Glyoxylate and dicarboxylate metabolism
    BSY239_1677
   00640 Propanoate metabolism
    BSY239_1677
   00650 Butanoate metabolism
    BSY239_1677
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY239_1677
   00072 Synthesis and degradation of ketone bodies
    BSY239_1677
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY239_1677
   00310 Lysine degradation
    BSY239_1677
   00380 Tryptophan metabolism
    BSY239_1677
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY239_1677
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY239_1677
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY239_1677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyr04147]
    BSY239_1677
Enzymes [BR:hyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY239_1677
Exosome [BR:hyr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY239_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOF84289
UniProt: A0A1B3LTW9
Position
1776145..1777320
Genome map
AA seq 391 aa AA seqDB search
MTNAVIVSTARTPLAKSWKGAFNMTHGATLGGHAVQHAVARAGIEAAEVDDVIMGCANPE
GATGANIARQIALRAGLPITTSGMTVNRFCSSGLQTIAMAAQRIIAGEGDVYVAGGVESI
SCVQQEMNTHMLADPWLAKNKPEIYWNMLQTAEQVAKRYGIGRDAMDEYGAASQQKATAA
LEAGLFKAEIAPITVTAGVADKVMGLTTKQVTVENDEGIRAGTTFEGIHGLRSALPGGLV
SAGNASQFSDGGGACVLMNETLAEKRGLTPLGRFLGFAVAGCEPDEMGIGPVFAIPKVLA
RLGLKVSDIDLWELNEAFAVQVIYCRDKLGIPGDRLNVNGGAIAVGHPYGVSGQRLTGHA
LIEGKRRGAKRVCVTMCIGGGMGAAGIFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgccgtcatcgtttccaccgcccgcacacccctggccaagagctggaagggc
gccttcaacatgacccacggagccaccctgggtggccacgcggtgcagcacgcggttgcc
cgcgccggcatcgaagccgccgaagtggacgacgtcatcatgggttgcgccaaccccgag
ggcgccaccggtgccaacatcgcgcgccagatcgcgctgcgcgccggcctgcccatcacc
acctcgggcatgaccgtcaaccgcttctgctcgtcgggtctgcagaccatcgccatggcc
gcccaacgcatcatcgcgggcgaaggcgacgtgtatgtggccggtggcgtggaaagcatt
tcgtgcgtgcagcaagagatgaacacccacatgctggccgacccgtggctcgccaagaac
aagcccgagatctactggaacatgctgcagaccgccgagcaggtggccaagcgttacggc
attggccgcgacgccatggacgagtacggcgctgccagccagcagaaggccacggccgcg
ctggaagccggcctcttcaaggccgagatcgcccccatcaccgtgaccgccggcgtggca
gacaaggtcatgggcctcacgaccaagcaggtgacggtggagaacgacgaaggcatccgc
gccggcaccacctttgaaggcatccacggcctgcgttcggcgctgccgggcggcctggtt
tcggccggcaacgccagccagttcagcgatggcggcggcgcctgcgtgctgatgaacgaa
accctggccgagaagcgcggcctgaccccgctgggccgtttcctcggctttgccgtggcc
ggctgcgagcccgacgagatgggcatcggcccggtgttcgccattcccaaggtgctcgcg
cgcctgggtctgaaggtgagcgacatcgacctgtgggaactcaacgaagccttcgcggtg
caggtgatctactgccgcgacaagctgggcatcccgggtgacaggctcaacgtcaacggc
ggcgccatcgcggtgggtcacccctatggcgtgtccggccagcgcctgaccggccacgcg
ctgatcgaaggcaagcgccgtggcgccaagcgcgtttgcgtgacgatgtgcattggcggc
ggcatgggcgcggccggcatttttgaagttctctga

DBGET integrated database retrieval system