KEGG   Hydrogenophaga sp. RAC07: BSY239_2162Help
Entry
BSY239_2162       CDS       T04455                                 

Definition
(GenBank) FAD binding domain in molybdopterin dehydrogenase family protein
  KO
K03519  aerobic carbon-monoxide dehydrogenase medium subunit [EC:1.2.5.3]
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY239_2162
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     BSY239_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_5 CO_deh_flav_C CREPT
Motif
Other DBs
NCBI-ProteinID: AOF85208
UniProt: A0A1B3LWI9
Position
complement(2297256..2298128)
Genome map
AA seq 290 aa AA seqDB search
MKAAAFDYVKPASIDQVIALLQEHGDDARLLAGGQTLMATLNMRLSEPQLVVDITGIESL
RGISVQGPVLRIGALATHTDIEFSPLVARHAPLLKAAAPHIAHRAIRNSGTFGGSIAYAD
PAAEWPTCLLALGGTVVARGPKGERRIAADDFFTGLYSTALQPDELLTACEIPLAGADHW
FGFSELARRHGDYAIVGMAATARREGDALHGLRIVLLGVDATPVRARQTETLLEARALDM
ATVTQAVASLRSEIDPLPDLTNTPDTKRHLAGVLLHRMLPTAATATTATA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgctgccttcgactatgtcaaacccgccagcatcgaccaggtgattgcgctg
ctgcaggaacacggcgacgacgcccgcctgctcgccggtggccagacgctcatggccacc
ctgaacatgcgcctgtccgagccgcagctggtggtcgacatcaccggcatcgaatcgctg
cgcggcatcagcgtgcagggcccggtgctgcgcatcggcgccttggccacgcacaccgac
atcgagttcagcccgctggtggcgcgccacgcgccgctgctcaaggcggccgcgccccac
atcgcgcaccgcgccatccgcaacagcggcacctttggcggctccatcgcctacgccgac
ccggccgccgagtggcccacctgcctgctggcgctggggggcaccgtggtggcgcgcgga
ccgaaaggcgaacgccgcatcgctgccgacgatttcttcaccggcctctacagcaccgcg
ctgcagcccgacgaactgctgaccgcgtgcgagattccgctggctggtgccgaccactgg
ttcggcttcagcgagctcgcgcgccgccacggcgactacgccatcgtgggcatggccgcc
accgcgcggcgcgaaggcgatgccttgcacggtctgcgcatcgtgctgctgggtgtggac
gccacgccagtgcgcgcgcgccagaccgaaacgctgctggaggcccgtgcgctcgacatg
gccaccgtgacccaggccgtggccagcctgcgcagcgagatcgacccgctgcccgacctg
accaacacccccgacaccaaacggcatctggcaggcgtgctgctgcaccgcatgttgccc
accgcggccaccgcaacgaccgccaccgcctga

DBGET integrated database retrieval system