KEGG   Hydrogenophaga sp. RAC07: BSY239_280Help
Entry
BSY239_280        CDS       T04455                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00220  Arginine biosynthesis
hyr00330  Arginine and proline metabolism
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
hyr01130  Biosynthesis of antibiotics
hyr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSY239_280 (rocF)
   00330 Arginine and proline metabolism
    BSY239_280 (rocF)
Enzymes [BR:hyr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSY239_280 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AOF87101
UniProt: A0A1B3M1X3
Position
complement(310431..311348)
Genome map
AA seq 305 aa AA seqDB search
MQKHISLIGVPTDIGAGTRGASMGPEAMRVANLASVLEGHGLNVIDRGNLSGPPNPWQPP
TDGYRHLPEVAAWNETLHHAVHAELALGRLPIVLGGDHCLGLGSISAVARHCRDTGKQLR
VLWLDAHADYNTAALTPSGNIHGMPVALLCGHGPALLTGIGGTTPAIDASVVRQIGIRSV
DAGEKRLVHEEGLEVFDMRYIDEMGMRHTMEQALAGMDDNTHLHVSFDVDFLDPDIAPGV
GTTVPGGPTYREAQLCMEMIADTGRLASMDVMELNPALDVRNRTAELAVDLIESLFGKST
LMRRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacacatcagcctcatcggcgtgcccaccgacatcggcgctggcacgcgcggc
gcctccatgggccccgaggccatgcgcgtggccaacctcgccagcgtgctcgagggccac
ggtctgaacgtgatcgaccggggcaacctgagcggcccgcccaacccctggcagccgccc
accgacggctaccgccacctgcccgaggtggcggcctggaacgagaccctgcaccacgcg
gtgcatgccgaactggcgctgggccgcctgcccatcgtgctcgggggcgaccactgcctg
ggcctgggctccatcagcgcggtggcacgccattgccgcgacaccggcaaacaactgcgg
gtgctctggctcgacgcccacgccgactacaacaccgccgcgctcacgcccagcggcaac
atccacggcatgccggtggcgctgctgtgcgggcacgggccggcgctgctcaccggcatc
ggcggcaccacgccggccattgacgcgagcgtggtgcgccagatcggcatccgcagcgtg
gacgccggtgaaaagcggctggtgcacgaagaagggctggaggtgttcgacatgcgctac
atcgacgagatgggcatgcgccacaccatggagcaggcgctcgcgggcatggacgacaac
acccacctgcacgtgagcttcgacgtggactttctcgaccccgacatcgcgcccggcgtg
ggcaccaccgtgcccggcggccccacctaccgcgaagcgcagctgtgcatggaaatgatc
gccgacaccggacggctggcgtccatggatgtgatggaactcaacccggccctggacgtg
cgcaaccgcacggcggagctggcggtggacctgatcgaaagcctgttcggcaagtccacg
ctgatgcggagaagctga

DBGET integrated database retrieval system