KEGG   Hydrogenophaga sp. RAC07: BSY239_427Help
Entry
BSY239_427        CDS       T04455                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00240  Pyrimidine metabolism
hyr00250  Alanine, aspartate and glutamate metabolism
hyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSY239_427 (pyrB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSY239_427 (pyrB)
Enzymes [BR:hyr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BSY239_427 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AOF87366
UniProt: A0A1B3M2S6
Position
472627..473583
Genome map
AA seq 318 aa AA seqDB search
MRRNPQLNKNGELIHLLSTEGLSRDILTQILDTAANFVSVSNREVKKVPLLRGKSVFNLF
FENSTRTRTTFEIAATRLSADVINLDIARSSTAKGESLLDTISNLSAMAADIFVVRHSES
GAPYLIAQHVAPHMHVINAGDGRHAHPTQGLLDMYTIRHYKQDFTKLSVAIVGDVLHSRV
ARSDIHALTTLGCPDVRVVGPRTLVPSDLSQMGVRVCHTLEEGIRDCDVVITLRLQNERM
SGALLPSSQEYFKSFGLTPERLRWAKPDAIVMHPGPINRGVEIDSAVVDGPQSVILPQVT
YGIAVRMAVMGIVAGNEA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacgcaatccccaactcaacaagaacggtgaactcatccacctgctctccaccgag
ggcctctcgcgcgacatcctcacgcagatcctggacaccgcggccaacttcgtgagcgtg
agcaaccgcgaggtgaagaaggtgcctctgttgcggggaaaaagcgtgttcaacctgttc
ttcgagaacagcacgcgcacccgcaccaccttcgagatcgcggccacgcgcctctccgcc
gacgtgatcaacctcgacatcgcgcgcagctccaccgccaagggcgagtcgctgctcgac
accatctccaacctcagcgccatggcggccgacatctttgtcgtgcgccacagcgagagc
ggcgcgccctacctgattgcgcagcacgtggcgccgcatatgcacgtgatcaacgctggc
gacggacgccacgcgcaccccacgcaggggctgctcgacatgtacacgatccgccactac
aagcaggatttcaccaagctctcggtggccatcgtgggcgacgtgctgcactcgcgcgtg
gcgcgctccgacatccacgccctgaccacgctgggctgccccgacgtgcgtgtggtcggc
ccgcgcaccctcgtgccgagcgacctctcgcagatgggcgtgcgcgtgtgccacacgctg
gaagaaggcatcagggactgcgacgtggtgatcacgctgcgcctgcagaacgaacgcatg
agcggcgcgctgctgccttccagccaggaatacttcaagagcttcggcctgacgcccgag
cgcctgcgctgggccaagccggacgcgatcgtgatgcacccgggcccgatcaaccggggc
gtggagatcgattcggcggtggtggatggtccgcagagcgtgatcctgccgcaggtcacc
tatggcatcgcggtgcgcatggcggtgatgggcatcgtcgcggggaatgaagcttga

DBGET integrated database retrieval system