KEGG   Hydrogenophaga sp. RAC07: BSY239_432Help
Entry
BSY239_432        CDS       T04455                                 

Definition
(GenBank) cytochrome C oxidase, cbb3-type, subunit III family protein
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY239_432
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BSY239_432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 PQQ_2 PQQ PQQ_3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AOF86092
UniProt: A0A1B3LZ33
Position
478509..479351
Genome map
AA seq 280 aa AA seqDB search
MSFNPATGLVYMPVQGVPLTLMDNKDWKFNGVRPGEPHSNMGWNTANFANVEPPTSKPYG
RLVAWDPVKQQAAWTKEQISPWNGGTLTTAGNLVFQGTADGRFIAYNATTGEPLWETPTG
TGVIAAPSTYLVDGKQYVSIAVGWGGVYGLAQRATDRQGPGTVYTFAVGGKAPAPAFVKY
QMDKLVAGVKYDPAHVPTGTALYVSNCVFCHGVPGVDRGGNIPNLGYMDASYIENLDKFV
FKGPATERGMPDFTGKLSMDDVQKIKAFIQGTADAIRPKN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcaacccggccaccggtctggtctacatgccggtgcagggcgtgccgctcacg
ttgatggacaacaaggactggaagttcaacggcgtgcgccccggcgagccgcactccaac
atgggctggaacacggccaatttcgccaacgtggagccgcccaccagcaagccctatggc
cgcctggtggcctgggacccggtgaagcagcaggccgcctggaccaaggagcagatctcg
ccgtggaacggaggcacgctcaccaccgcgggcaacctggtgttccagggcacggccgac
gggcgcttcatcgcctacaacgccaccaccggcgaaccgctgtgggaaacgcccaccggc
accggcgtgatcgccgcgccatcgacctacctggtggatggcaagcagtacgtgtcgatc
gccgtgggctggggcggtgtgtacggcctggcgcagcgcgccaccgaccgccagggcccg
ggcacggtctacaccttcgccgtgggtggcaaggcgcctgcgccggccttcgtgaagtac
cagatggacaagctggtggcgggggtgaagtacgacccggcgcacgtgcccaccggcacc
gcgctgtacgtgagcaactgcgtgttctgccacggcgtgcccggcgtggaccgtggcggc
aacatccccaacctgggctacatggacgcgtcctacatcgagaacctggacaagttcgtg
ttcaagggcccggccaccgagcgcggcatgcccgacttcacgggcaagctgagcatggac
gacgtgcaaaaaatcaaggccttcattcaaggaacggccgacgcgatccgacccaagaac
tga

DBGET integrated database retrieval system