KEGG   Hydrogenophaga sp. RAC07: BSY239_479Help
Entry
BSY239_479        CDS       T04455                                 

Definition
(GenBank) putative membrane protein
Organism
hyr  Hydrogenophaga sp. RAC07
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AOF85611
UniProt: A0A1B3LXK7
Position
521211..521333
Genome map
AA seq 40 aa AA seqDB search
MARNLTPEQKKHNQRLGLILGSIALVFFMGFVGKMVFLGG
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaacttgacgcccgaacagaagaagcacaaccagcgcctgggcctgatcctg
ggctcgatcgcgctggtgttcttcatgggttttgtcggcaagatggtgtttctgggcggc
tga

DBGET integrated database retrieval system