KEGG   Hydrogenophaga sp. RAC07: BSY239_482Help
Entry
BSY239_482        CDS       T04455                                 

Definition
(GenBank) cytochrome c oxidase subunit III family protein
  KO
K02276  cytochrome c oxidase subunit III [EC:7.1.1.9]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00190  Oxidative phosphorylation
hyr01100  Metabolic pathways
Module
hyr_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSY239_482
Enzymes [BR:hyr01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     BSY239_482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX3 DUF420
Motif
Other DBs
NCBI-ProteinID: AOF85682
UniProt: A0A1B3LXV3
Position
522238..523119
Genome map
AA seq 293 aa AA seqDB search
MSAASHGTTPYYYVPGPSRHPVMASIGLFFVILGAGQWINGAGWGAYSLAFGMAFWLFVL
FQWFSESVRESESGMYGRKIDLSFRWSMSWFIFSEVMFFGAFFTALWWARVHSVPALGGF
ENSLIWPDFSAVWPSVQAGATASPGGIVEPFQTMGPFWLPTINTALLLTSGVTLTIAHHA
LQVGNRGKTIAFMWMTVLLGIVFLIVQGYEYYHAYTDLNLKLSSGIFGSTFFMLTGFHGF
HVFVGMLMLLFITLRLQKGHFTKDRHFGFEGAAWYWHFVDVVWLGLYILVYWL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagcatcccacggcacaacgccttactactacgttcccggcccctcgcggcac
ccggtgatggcgtcgatcggtctgttcttcgtcatcctcggcgcaggccagtggatcaac
ggtgcgggttggggcgcgtactcgctcgcgttcggcatggccttctggctgttcgtgctg
ttccagtggttcagcgaatcggtgcgcgagagtgagagcggcatgtacggtcgcaagatc
gacctgtcgttccgctggagcatgagctggttcatcttctcggaagtcatgttcttcggt
gcgttcttcaccgctctctggtgggcgcgtgtgcactcggtgccggctttgggtggcttc
gagaactcactgatctggcccgacttctcggccgtgtggcccagcgttcaggctggcgcc
acggcgtcgcccggtggcattgtcgagcccttccagaccatgggcccgttctggctgccc
acgatcaacactgcgctgctgctgacttcgggtgtcacgctcaccatcgcgcaccacgcg
ctgcaggtgggcaaccgcggcaagaccatcgccttcatgtggatgacggtgctgctgggc
atcgtgttcttgatcgtgcagggctatgagtactaccacgcctacaccgatctgaacctc
aagctcagctccggcatcttcggctccaccttcttcatgctgaccggtttccacggcttc
cacgtgttcgtgggcatgctgatgctgctgttcatcaccctgcgcctgcagaaggggcac
ttcaccaaagaccgccacttcggcttcgaaggcgcggcctggtactggcacttcgtggac
gtggtgtggctgggtctctacatcctggtctattggctgtga

DBGET integrated database retrieval system