KEGG   Hydrogenophaga sp. RAC07: BSY239_547Help
Entry
BSY239_547        CDS       T04455                                 

Definition
(GenBank) eamA-like transporter family protein
Organism
hyr  Hydrogenophaga sp. RAC07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TPT CRT-like
Motif
Other DBs
NCBI-ProteinID: AOF86263
UniProt: A0A1B3LZI5
Position
complement(581674..582609)
Genome map
AA seq 311 aa AA seqDB search
MSASPPHRLTPATIALLLIPPLMWAGNAVVGRLMQGVVPPVTLNFLRWVLAMVMLLPVAG
WVLRPGSGLWTHWRRFALLGLLGVGMYNSLQYMALKTSTPLNVTLVASSIPVWMLIMGRV
FYDVPISRRAALGALMSLCGVVVVIARGDLGGLLSVQLVPGDLLVLLAALAWAWYSWLLA
RPPANEPAAIKADWAAFLLAQMVFGLLWSAAFTGGEWLTMPALPAGESAIQWGWPLVAGL
VFVAVGPSLLAYRSWGAAVARVGPATASVFSNLTPLFAALMSATLLREPPQLYHLAGFVL
IVGGILVSSRR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttcgcccccgcaccgcctcacccccgccaccatcgccctgttgctgatcccg
ccgctcatgtgggcgggcaacgccgtggtgggtcgcctcatgcagggcgtggtgccgccg
gtcacgctgaatttcctgcgctgggtgctggccatggtcatgctgctgccggtggcgggc
tgggtgttgcgcccgggcagtggcctgtggacgcattggcggcgctttgccttgctcggc
ctgctgggggtgggcatgtacaactcgctgcagtacatggccctgaagacctccacgccg
ctcaacgtgacgctggtggcgtcgagcattccggtgtggatgctgatcatggggcgcgtg
ttctacgacgtgcccatttcgcggcgcgcggcgctgggggcgctgatgtcgctctgcggc
gtggtggtggtgatcgcacgtggagatctgggtggcttgctgtcggtgcagctggtgccg
ggcgatctgctggtgctgctggccgcgctggcctgggcctggtacagctggctgctggcg
cgcccaccggccaacgagcccgcggccatcaaggccgactgggccgccttcctgctggcc
cagatggtcttcggtctgctctggtcggccgccttcaccggcggggaatggctcaccatg
cccgcgttgccagcgggcgaaagcgccattcaatggggttggccgctggtggccggcctg
gtgttcgtggcggtgggcccgtcgctgctggcctaccgcagctggggcgcggccgtggcc
cgcgtgggcccggccacggccagcgtgttttccaacctcacgccgctgttcgccgcgctg
atgtcggccacgctgctgcgcgagccgccccagctctaccacctggccggctttgtgctg
atcgtgggcgggattctggtgtcgtcacggcgctag

DBGET integrated database retrieval system