KEGG   Hydrogenophaga sp. RAC07: BSY239_711Help
Entry
BSY239_711        CDS       T04455                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00520  Amino sugar and nucleotide sugar metabolism
hyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSY239_711
Enzymes [BR:hyr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     BSY239_711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short NAD_binding_10 KR adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AOF85960
UniProt: A0A1B3LYR6
Position
complement(753276..754253)
Genome map
AA seq 325 aa AA seqDB search
MHILLTGAAGFIGMHTALRLLARGDTVLGIDNLNDYYDVALKQARLAPLRQHAGFQFEQI
DVADRQAMARLFAGERFDAVVHLAAQAGVRYSITHPNAYLDSNLSGFGHVLEGCRAQQLG
HLVYASSSSVYGGNTKMPFEETDAVDHPVSLYAATKKANELMAHTYSHLYGLPTTGLRFF
TVYGPWGRPDMAYYSFTQAMLAGHPIKVFNHGQMKRDFTYIDDIVEGVLRVLDKPATPQN
AGGPPYRIFNIGNHDPVPLLEFIGCIETALGRTADKQFLPMQDGDVPATYASTDALREWV
GFAPSTPLAEGIQRFVAWYRQYHQV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcctcctcaccggcgccgccggctttatcggcatgcacaccgccctgcgcctg
ctggcgcgcggcgacacggtgctcggcatcgacaacctcaacgattattacgacgtggcg
ctcaagcaggcccggctcgcgccgctgcggcagcacgcgggttttcagttcgagcagata
gacgtcgccgaccgccaggccatggcccggttgtttgcgggcgagcgtttcgacgcggtg
gtgcatctcgcggcgcaagccggcgtgcgctattcgatcacgcaccccaacgcctacctc
gacagcaacttgagcggcttcggccatgtgctcgaaggctgccgcgcgcagcagctgggc
cacctggtctacgcatcaagctccagcgtgtacggcggcaacaccaagatgcccttcgag
gagaccgacgcggtcgaccacccggtgagcctgtacgcggccaccaaaaaggccaacgag
ttgatggcccacacctacagccacctctacggcctgcccaccaccggcttgcgcttcttc
accgtttacggcccctggggcaggcccgacatggcctactactcgttcacccaggccatg
ctcgcgggccacccgatcaaggtgttcaaccacgggcagatgaagcgcgatttcacctac
atcgacgacatcgttgaaggcgtgctgcgcgtgctggacaaaccggccacgccgcagaac
gcgggcggcccgccctaccgcatcttcaacatcggcaaccacgacccggtgccgctgctg
gagttcatcggctgcattgaaaccgcgctgggtcgcacggccgacaaacagttcctgccc
atgcaggacggtgatgtgcccgccacctacgccagcaccgacgcgctgcgcgagtgggtg
ggctttgcaccttcaacgccgctggccgagggcatccagcggtttgtggcctggtaccgc
caatatcaccaggtctga

DBGET integrated database retrieval system