KEGG   Hydrogenophaga sp. RAC07: BSY239_958Help
Entry
BSY239_958        CDS       T04455                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSY239_958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOF84741
UniProt: A0A1B3LV59
Position
1023556..1025151
Genome map
AA seq 531 aa AA seqDB search
MPKKARSSFISKHQEALQLGAAVLFLILVGVYASLTGASTIGLTSSAVWLLIVAASVGAY
MAMNIGANDVANNMGPAVGSGAMTMGWAIVVAAVFEALGAIVAGGDVVGTIKGGIIDPAA
INDPALFAWVMFSALLAGALWLNLATALGAPVSTTHSIIGAVMGAGIAAGGWGLVNWDTI
GAIVISWVISPLMGGALAAGFLYLIKRSVTYRSDKTDAASRVVPVLISLMVWAYTTYMLL
KGVSQLVKVGFLTALAIGLVVSVVVWWLIRRPIARMAVRQDNSKDGVNRLFTWPLICSAA
LLSFAHGANDVANAIGPLAAIYEAVKEGAIATKAGTPMWIMVLGALGLAVGLALYGARLI
RTVGKEITELDNMRAYSIAMSATLTVIVASQLGMPVSTTHISIGAVFGVGFLRELLKVNY
AKMEAVVFAGHQGADRAEVEAYLHRFEAAEVQEKKRMLAEMKRRTKQREATQTAEGALLA
KKEQRAMKKAIKKEIVKRSAVMRIVAAWIVTVPATAVLAAILFYVVRAVLS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaaaagcccgtagcagcttcatttccaagcaccaggaggccctgcaactgggt
gctgcggtgttgttcctgatcctggtgggggtgtacgcctcgctcaccggtgcctccacc
atcggactcacctcctcggcggtgtggttgctgatcgtggccgccagtgtgggcgcctac
atggccatgaacatcggtgccaacgacgtggccaacaacatgggcccggcggtgggctcg
ggtgccatgaccatgggctgggccatcgtggtggcggccgtgttcgaagcactcggcgcc
atcgtcgcggggggcgacgtggtcggcaccatcaagggcggcatcatcgacccggccgcc
atcaacgaccccgcgctgttcgcctgggtcatgttctcggcgctgctggccggtgcactc
tggctcaacctggccactgcgttgggtgcgccggtgtccaccacccactccatcatcggc
gccgtcatgggcgcgggcatcgcagcgggcggttggggcctggtcaactgggacactatc
ggcgccatcgtcatcagctgggtgatctcgccgctcatgggcggggcactcgccgcgggt
ttcctctacctcatcaagcgcagcgtgacctaccgcagcgacaagacggatgccgccagc
cgcgtggtgccggtgctcatttcgctcatggtctgggcctacaccacctacatgctgctc
aagggcgtgagccagttggtcaaggtcggcttcctgaccgccctggccatcggcctcgtg
gtgtccgtggtcgtgtggtggctgatccgcaggccgattgcgcgcatggccgttcggcag
gacaacagcaaggacggcgtgaaccgcctgttcacctggccgctgatctgctcggccgca
ctgctgagttttgcgcacggcgccaacgacgtggccaacgccatcggaccgctggcggcg
atctacgaagcggtgaaagagggcgccatcgccaccaaggcgggcacgccgatgtggatc
atggtgctcggtgcgctgggcctggcggtcggtctggcgctgtatggcgcgcggctgatt
cgcacggtgggcaaggagatcaccgagctcgacaacatgcgcgcctactcgatcgccatg
tcggccacgctcaccgtgatcgtcgcctcgcagctcggcatgcccgtgtccaccactcac
atctccatcggcgcggtgtttggcgtggggttcttgcgcgagctgctcaaggtgaactac
gccaagatggaagcggtggtgtttgccggccaccaaggtgccgaccgtgccgaggtcgag
gcctacctgcaccgcttcgaagcggccgaggtgcaggagaaaaaacgcatgctggccgag
atgaagcgccgcaccaaacagcgcgaagcgacacaaaccgccgagggtgccctgctggcg
aagaaggaacagcgcgccatgaagaaggcgatcaagaaagagatcgtcaagcgctcggcc
gtcatgcgcatcgtggccgcgtggatcgtcaccgtgcccgccacggcggtgctcgcggcc
attcttttctacgtcgttcgggccgtgctcagctga

DBGET integrated database retrieval system