KEGG   Hydrogenobaculum sp. SN: HydSN_0844Help
Entry
HydSN_0844        CDS       T02516                                 

Definition
(GenBank) Undecaprenyl-phosphate galactose phosphotransferase, WbaP/exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
hys  Hydrogenobaculum sp. SN
Brite
KEGG Orthology (KO) [BR:hys00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hys01005]
    HydSN_0844
Enzymes [BR:hys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     HydSN_0844
Lipopolysaccharide biosynthesis proteins [BR:hys01005]
 O-antigen
  HydSN_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf PglD_N CoA_binding_3 IstB_IS21_ATP
Motif
Other DBs
NCBI-ProteinID: AGH93444
Position
complement(760004..761428)
Genome map
AA seq 474 aa AA seqDB search
MKGSLRFFLLISIDVLAFYIALFLAYITRKILGRIFIKNVVFSFSFEHFLSFWWMPLVFI
FFLWYQKLYTRRYTFWYEVKEVLKAVFLSGVFAFAVLSLSKISLEMSRLTLILLCFYAIF
TISILRYIGKKILNHFDIWKSPIVIIGAGSSGKSVAKGIIDDWYLGYEIKGFLDDFKSGF
VEIKGFKIPIIGKVEKIKELKEENIEAAVVSIPSLGNEELAHLVNTAHRYIKQVFVVPDL
KGIGLLNSELYHIFTEQLFLIKITNNLDSKLNQIIKQTFDILLSLTMLPILLFVISIFAI
LIKIDSEGPVFFVQERLGKNGKIFKCIKFRTMYINNQEILENFLKENQDAQLEWQTFKKL
KKHDPRITRVGRFLRKTSLDELPQIFNVLKGDMSLVGPRPYLPSEEKDMGDYKDYILLTK
PGITGLWQVSGRNELSFEERLKLDTWYVLNWSLWFDIVIILKTVKVVFKKEGAY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggtcattaagattttttttacttatatcaatagatgttttggctttttatatt
gcactttttttagcttatataacaagaaaaatattggggagaatatttataaaaaatgtt
gttttttcgtttagttttgagcattttttatctttttggtggatgcctcttgtgtttata
ttttttttatggtatcaaaagctttatacaagaagatacaccttttggtatgaggtaaaa
gaggtactaaaagcagtttttttatcgggtgtttttgcctttgcggtgctgtctcttagt
aaaatctctttagagatgtctaggcttaccttgatacttctttgtttttacgctattttt
actatatctattttaaggtacatagggaaaaagatattaaaccattttgatatttggaaa
agcccaatagttataataggggctgggtcctctggaaaaagcgtagcaaagggcattata
gatgactggtatcttggatatgaaataaaagggtttttagatgattttaaaagtgggttt
gttgaaataaaaggttttaagataccaataataggaaaagtagaaaaaataaaagagcta
aaagaagagaatatagaagctgctgttgtttctataccatctttgggtaatgaagagctt
gctcaccttgtaaacacagcccatagatatattaagcaggtgtttgtagtgcctgatttg
aagggtatagggcttttaaatagtgaattgtatcatatttttacggaacagcttttttta
ataaagattacaaacaacctagattcaaagctaaaccaaataataaaacagacttttgat
atcttactatctttgactatgcttcctatattgctttttgttataagtatctttgccata
ttgataaagatagacagcgaaggaccggtgttttttgtacaagaaagattgggcaaaaac
ggcaagatattcaaatgtataaagtttaggacaatgtatataaataatcaagagatacta
gaaaattttttaaaggaaaaccaagacgctcagttagaatggcaaacttttaaaaaatta
aaaaagcatgacccaagaattacaagagtaggtaggtttttacgaaaaacctctttagac
gagcttcctcaaatattcaacgttttaaaaggggatatgagcttagtaggcccaaggcct
tacttgccttccgaggaaaaggatatgggagattacaaagattatatacttcttacaaaa
ccaggtattacaggcctatggcaagtaagcggaagaaacgagctttcttttgaggaaagg
cttaaactagatacttggtatgtgttaaattggtcgctttggtttgatatagtaataata
cttaaaacagttaaggttgtcttcaaaaaagaaggggcttattag

DBGET integrated database retrieval system