KEGG   Hydrogenobaculum sp. SN: HydSN_0910Help
Entry
HydSN_0910        CDS       T02516                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
hys00340  Histidine metabolism
hys01100  Metabolic pathways
hys01110  Biosynthesis of secondary metabolites
hys01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hys00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HydSN_0910
Enzymes [BR:hys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HydSN_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF3458_C KLRAQ
Motif
Other DBs
NCBI-ProteinID: AGH93504
Position
824116..825396
Genome map
AA seq 426 aa AA seqDB search
MITIEDFTIKDFKSSKILEKILNRAKVFEQQYLDKVREIIENVIKYKDEALYKYALEFDN
IDLRKEGIEIPKEAIENAYKELDENTKKALQFSYERVYKFHENQKEKSFITEEEGIMLGQ
RVLPVESAGLYVPGGKAAYPSSVIMNAVPAKVAGVSNIYMVCPKPTKEVLAAAYICGIDR
VFRIGGAQSIAALAYGTETIPAVEKIVGPGNIYVATAKRLVYGIVGIDMIAGPSEVLIIA
DASADPSFVAMDMLSQAEHDELASAILITNCEDLAYSVAKEIDVFLSQLERKDIASKSIE
NYGAIFIVKNLEKACELSNMIAPEHLEINTENPFELLGFIKNAGAIFLGEYTVEALGDYC
LGPNHTLPTGRSARFSSALGVYDFVKRSSVLYVSKKGFDKVKHHAHNLAKAEGLHAHASS
IELRGL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattactattgaagattttacaattaaagattttaaaagctcaaaaatcttagagaag
attttaaacagagctaaggtgtttgaacagcagtatctagataaggtaagagagataata
gaaaacgttataaaatacaaagatgaggctttatataaatacgcccttgagtttgataac
attgaccttagaaaagaaggcatagagataccaaaagaagccatagaaaacgcttacaaa
gagttggatgagaacaccaaaaaggctcttcaattttcttatgaaagggtgtataaattc
catgaaaatcaaaaagagaaatctttcataacagaagaagaaggtataatgttggggcaa
agggtattaccagtagaaagtgcaggtctttatgtaccaggaggcaaagccgcctatcca
tcttctgttattatgaacgcagtgcctgcaaaagtagctggtgtttctaatatttatatg
gtatgtccaaaacccacaaaagaagttttagccgctgcttatatatgtggcatagataga
gtatttagaataggtggagctcaaagtatagcagcattagcttatggcactgagacaata
ccagctgtagaaaagatagtcggccctggtaatatatacgttgccactgcaaaaagattg
gtgtatggcatagtgggcatagatatgatagctggtccttcggaagtgcttattatagcc
gatgcttctgcagatccaagctttgttgccatggatatgctatcccaagctgaacatgat
gaactagctagtgctattttgataacaaactgtgaagatttggcttactcagtggccaaa
gagattgatgttttcttatcacagttagaaagaaaagatatagcctcaaaatctatagaa
aactacggagctatatttatagtaaaaaacttagaaaaagcctgtgaactatccaatatg
atagccccagagcatcttgaaataaatacagaaaacccttttgagcttttaggatttata
aaaaatgccggtgctatattcttaggagagtatacggtggaagctttgggagattattgt
cttggtccaaaccatacgctacctactggaagaagtgcaaggttttcatcggctttaggt
gtttatgattttgtaaaacgctcttcggtgctttacgtgtcaaaaaaaggctttgacaaa
gtaaaacaccatgcccacaaccttgcaaaagccgaaggtcttcacgctcatgcatcctct
atagaattaagaggtttatga

DBGET integrated database retrieval system