KEGG   Hymenobacter sp. PAMC 26628: AXW84_08570Help
Entry
AXW84_08570       CDS       T04961                                 

Definition
(GenBank) fructose-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
hyz  Hymenobacter sp. PAMC 26628
Pathway
hyz00010  Glycolysis / Gluconeogenesis
hyz00030  Pentose phosphate pathway
hyz00051  Fructose and mannose metabolism
hyz00680  Methane metabolism
hyz01100  Metabolic pathways
hyz01110  Biosynthesis of secondary metabolites
hyz01120  Microbial metabolism in diverse environments
hyz01130  Biosynthesis of antibiotics
hyz01200  Carbon metabolism
Module
hyz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hyz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXW84_08570
   00030 Pentose phosphate pathway
    AXW84_08570
   00051 Fructose and mannose metabolism
    AXW84_08570
  09102 Energy metabolism
   00680 Methane metabolism
    AXW84_08570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyz04147]
    AXW84_08570
Enzymes [BR:hyz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AXW84_08570
Exosome [BR:hyz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXW84_08570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: AMJ65475
UniProt: A0A126P8M3
Position
1943984..1944997
Genome map
AA seq 337 aa AA seqDB search
MDHNKMALPVGATLDRFIMRKQEDFPYATGELSQLLRDIALAAKIVNREINRSGLIDIAG
AYGSQNVQGEDQQKLDVVANIRFIRALRNGGEVCTIISEEDEEMIQTGNVQGKYVVAIDP
LDGSSNIDVNVSIGTIFSIYRRMSPTGRDGTAADCLQPGTHQVAAGYVIYGSSTMLVYTT
GNGVNGFTYEPSLGEFFLSHPDIQTPTTGTVYSVNEGSSSSFAPAVAAYVQQCKAQGFSA
RYIGSLVADFHRNLLKGGIYFYPATAKNSSGKLRLMYECNPLAFIVEQAGGKSSNGTRRT
MEIEPQALHERCPVFIGSKELVEEVERLIAENAGATA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaccacaacaaaatggccctgcccgtcggtgccaccctcgaccgcttcatcatgcgc
aagcaggaagacttcccctacgccaccggggaactctcgcagctgctgcgtgacatagca
ctggcggccaaaatcgttaatcgcgaaatcaaccgctcgggccttattgacattgccggg
gcctacggcagccaaaacgtgcagggcgaagaccagcaaaagctcgacgtggtggccaac
atccgcttcatccgggccctgcgcaacggcggtgaggtatgcaccatcatctcggaggag
gacgaggagatgattcaaaccggcaacgtgcagggcaagtacgtggtggccatcgacccg
ctcgacggctcgtcgaacatcgacgtgaacgtgagcatcggcaccattttcagcatctac
cggcgcatgtcgcccaccggccgcgatggcacggccgccgactgcctccagcccggcacc
caccaggtggccgctggctacgtcatctacggctccagcaccatgctcgtgtacaccacc
ggcaacggcgtaaacggcttcacttacgagccctcactgggcgaatttttcctctcgcac
cccgacattcaaacgcccaccaccggcaccgtctactccgtgaacgagggcagctcctcc
tcgtttgcgcccgctgtggcagcctacgtgcagcaatgcaaggcgcagggcttctcggcc
cgttacatcggctcgctagtagccgattttcaccgcaacctactcaagggtggcatctat
ttttaccccgccactgccaaaaactccagcggcaagctccgccttatgtacgaatgcaac
ccgctggcattcattgtagaacaggccgggggcaaaagctcgaacggcacccgccgtacc
atggaaatcgagccccaggcgctgcacgagcgctgccccgttttcatcggcagcaaagag
ttggtggaagaagtcgagcggctaattgccgaaaacgccggggccacggcgtag

DBGET integrated database retrieval system