KEGG   Ignisphaera aggregans: Igag_0264Help
Entry
Igag_0264         CDS       T01307                                 

Definition
(GenBank) phosphoribosylformylglycinamidine synthase II
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
iag  Ignisphaera aggregans
Pathway
iag00230  Purine metabolism
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:iag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Igag_0264
Enzymes [BR:iag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Igag_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS FGAR-AT_linker
Motif
Other DBs
NCBI-ProteinID: ADM27113
UniProt: E0SQN9
Position
223287..225482
Genome map
AA seq 731 aa AA seqDB search
MPLTNDEIEEIKRILGREPTVEELAMFEAQWSEHCSYKSSRLLLRLLPTKAKHVVLGPGR
DAPAVEVFPDVLVVFKIESHNHPSAVDPYNGAATGIGGIVRDILTLGAKPIALLDLLYMG
NPRDPHANWLIRGIVKGISDYGNRIGIPTVAGDTWFDEAFNKQPLVNVACVGIVSPDKAV
LSGPKSGDLILIIGNATGRDGLLGSSFASRPLAEDVDKDIGAVQVGDPLTEKLLIDVIQI
LVEKNLVNYIKDLGGGGLTTALSESAADHGLGAVIYLDKLHTRQSLTPLELLVSESQERM
LLAVPPTKIEDVKNILEGYEVPYSIIGYFDDSGIIKVFYMDRKVVEAPAKELAKPRAIRR
PSKPPTEALKGFEPIILPDTEIDIEKTILLLLSSPNIASKKWIYEQYDHEVGARTIIKPG
YGDAAVLRLLDGSRRGIAVKGDANPRYTYLDPFNGAANVVSECYRNLTAVGSTPLAIVDE
LNAGNPEKPEHYWYFEEMLKGLAWISDELGLPIVGGKVSFYNEDSRGVQVKPTLTVVGVG
RIDDISYARGMGFREYGSYIVVIGTTYPEIGGTEYLYRVHGIEHGEIPKPRPTYEISHGN
IVRRLIHRDIALSVHDIGLGGLGIALIEMAIVSGIGFDVDLSVIPMRAVDRLDVLLFSET
QARYIIEIDGRRLDEAKKILDESSVVYSVIGVTKGYEKTVFRYNGNVVASIDLINAVDIY
MNSLERELEVV
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
gtgccattaacaaatgatgagatagaagagatcaagaggatcctagggagggaaccaaca
gtagaagagcttgctatgtttgaagcacagtggagtgagcattgttcctataagagtagt
agattgttgctaagacttttacctacaaaagcaaaacatgttgttttggggccgggtaga
gatgctccagctgtagaagtttttccagatgttctagtagtctttaagattgagagtcat
aatcatccatcagctgtagatccctataatggagctgcaacaggtatagggggtattgta
agagatattctaacccttggtgcaaaaccaatagcactcctggatcttctatacatgggc
aatccaagagatcctcatgcaaattggcttataagaggtattgtaaagggtattagcgac
tatgggaataggatagggataccaactgtagctggagacacatggtttgatgaagccttc
aataaacagcctcttgtgaatgttgcatgtgtaggtatagtatctcctgataaagctgtt
ttatcgggtccaaaatcaggggatctaatacttattataggtaatgcaacaggtagagat
ggtctcttgggaagcagctttgcttcacgtccactagcagaagatgttgacaaagatata
ggtgctgtccaggttggagatcccctaactgagaagcttctcatagatgttatccagatt
cttgtagagaaaaatcttgtgaactacataaaggatcttggcggcggaggcctcacaaca
gctttaagcgaatctgctgctgatcatggtcttggagcagttatttatctagacaagctc
cacactagacagagcttaacacctctagaactcttggtatctgagagccaggagagaatg
cttctagcggttccacctacaaagatagaggatgtgaaaaacattcttgaggggtatgag
gttccctatagcattataggatattttgatgatagtggtattataaaagtattttatatg
gatagaaaggttgttgaagcacctgctaaagaactcgcaaaaccaagggctatcagaaga
ccgtcaaaacctccaacagaagctttgaaggggtttgagccaattatactaccagatact
gagatagatatagagaagacaattctcttgcttctatcgtcacctaatatcgcttcaaag
aaatggatctatgaacagtatgaccatgaggtcggtgctagaactataataaaacctgga
tatggtgatgcagctgtactaagacttttagatgggtctagaagaggtatagcagttaaa
ggagatgcaaatcctagatatacctatctagatccattcaacggtgcagcaaatgttgta
tctgaatgctatagaaatctaacagctgtaggatcaacacctcttgcaattgttgacgaa
cttaatgctggaaatccagagaagcctgagcattattggtattttgaggaaatgttgaag
ggtcttgcctggatatctgatgaacttggtcttcccatagtcggtggaaaggttagtttc
tataacgaggactcaagaggtgttcaagtaaaaccaacactaactgtggtaggtgttgga
aggattgatgatattagttatgctaggggtatgggctttagagaatatggctcatacata
gtagttataggtactacatatccagagattggaggtacagaatatctatatagagtacat
ggaatagaacatggagagatacctaagccaagaccaacatatgaaattagccatggcaat
atagttagaaggcttatacatagagatatagctttatctgtccacgatataggtcttgga
ggtcttggaatagctctcatagagatggctatagttagtggaataggttttgatgtagat
ctctccgttattcctatgagagctgttgatagattggatgttctattattttcagagaca
caggccagatatattattgaaatcgatggtagaaggcttgatgaagctaagaagattctt
gatgaaagtagtgttgtgtatagtgttataggtgttacaaagggttatgaaaagacagtg
tttagatacaatggaaacgttgtagcctccatagatctcatcaatgctgtagatatatac
atgaactctcttgagagagagctggaggtggtatag

DBGET integrated database retrieval system