KEGG   Ignisphaera aggregans: Igag_0470Help
Entry
Igag_0470         CDS       T01307                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
iag  Ignisphaera aggregans
Pathway
iag00010  Glycolysis / Gluconeogenesis
iag00052  Galactose metabolism
iag00500  Starch and sucrose metabolism
iag00520  Amino sugar and nucleotide sugar metabolism
iag00521  Streptomycin biosynthesis
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01120  Microbial metabolism in diverse environments
iag01130  Biosynthesis of antibiotics
iag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_0470
   00052 Galactose metabolism
    Igag_0470
   00500 Starch and sucrose metabolism
    Igag_0470
   00520 Amino sugar and nucleotide sugar metabolism
    Igag_0470
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Igag_0470
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Igag_0470
Enzymes [BR:iag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Igag_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADM27308
UniProt: E0SRN3
Position
complement(420049..421074)
Genome map
AA seq 341 aa AA seqDB search
MFLGNQYVIGIDIGATWTRIALARVDGSIASRHVFRTPREGDRYTIANTIISSIRREFSN
YLDNVKAIGIGTIGPLDLTQGMVINSPNVAIRTFEVAKPILEEFKKPVVMANDCVTAVWG
EKYFGLGRGYSNIVYITISTGIGGGIIVDDTLLLGKMGNAHEIGHIVVDTSGKMECGCGG
KGHWEAYASGANIPRFAYRLIDEWNLTQNERESPVYRAYLNRELTSELIYTYAKKGDSLA
LRIINEVNKYNIAGFENVINSYDPEIITVGGSVALRNPELVVEPIVRGIENSKGVVTARP
RIDVTPLGDDIVLIGALALALYPPPNLVKKLRYLESISIDL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgggtaatcaatatgttataggaatagatataggtgctacatggacacgtata
gctttggctagagtagatggatctatagctagtagacatgtttttagaactcctagggag
ggtgatagatatacaattgcaaatactataatcagtagtataagaagggaattctcaaac
tatttagataatgttaaggctattggtattggaactataggtcctcttgatctaactcaa
ggtatggtcataaactctccaaatgtagctatacgtacatttgaagtagctaaacctatt
ttagaggaatttaaaaagcctgtagtaatggctaacgactgtgttactgctgtatggggt
gaaaaatattttggtcttggtagagggtatagcaatattgtttatataactataagtact
ggtataggaggtggtattattgttgatgatacactactcctaggaaagatgggaaatgct
catgagataggacatatagttgtagatactagtggaaaaatggaatgtgggtgtggagga
aagggtcattgggaagcatatgcaagtggtgcaaatataccgaggtttgcatatagactc
atagatgagtggaacttaacacaaaatgaaagagaatcaccagtatatagagcatacctc
aatagagaacttacatcagaacttatctatacatatgctaagaaaggtgatagcctagct
ctaaggattatcaatgaagttaataaatataatatagctggatttgaaaatgttataaat
tcctatgatccagagattataacagttggaggatctgttgctctaagaaatccagaactt
gttgtagagcccatagtaagaggtattgagaattcaaaaggtgttgtaacagctcgtcca
agaatagatgtaacaccacttggagatgatatagttctaataggagcattagcattagca
ctatatccaccaccaaatcttgtgaaaaaacttaggtatctcgaatctatatccatagat
ctataa

DBGET integrated database retrieval system