KEGG   Ignisphaera aggregans: Igag_1229Help
Entry
Igag_1229         CDS       T01307                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
iag  Ignisphaera aggregans
Pathway
iag00010  Glycolysis / Gluconeogenesis
iag00030  Pentose phosphate pathway
iag00051  Fructose and mannose metabolism
iag00052  Galactose metabolism
iag00230  Purine metabolism
iag00500  Starch and sucrose metabolism
iag00520  Amino sugar and nucleotide sugar metabolism
iag00521  Streptomycin biosynthesis
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01120  Microbial metabolism in diverse environments
iag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1229
   00030 Pentose phosphate pathway
    Igag_1229
   00051 Fructose and mannose metabolism
    Igag_1229
   00052 Galactose metabolism
    Igag_1229
   00500 Starch and sucrose metabolism
    Igag_1229
   00520 Amino sugar and nucleotide sugar metabolism
    Igag_1229
  Nucleotide metabolism
   00230 Purine metabolism
    Igag_1229
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Igag_1229
Enzymes [BR:iag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Igag_1229
    5.4.2.8  phosphomannomutase
     Igag_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADM28035
UniProt: E0SPA8
Position
complement(1151969..1153348)
Genome map
AA seq 459 aa AA seqDB search
MNMERKLFGTDGVRWIVDKESLDFVLRLAMAIGSYFPKGSRALVGMDGRLGNSAIYGTVL
SALSASGSKVYDAGLLPTPALQYCVKEFGFDYGVMVTASHNPPEWVGIKLILSDGIEAPP
NVDVEVESILFESKFRRVQWYEVRSIEKFEGAIGYYIDAIKKHVDVEKIRKKQIKVVVDC
ANSVSALTTPRTLKELGLKVLSINSDIGIPYRPYEPTPENLYELMSIVKAVGADFGVAHD
GDGDRAVFIDNLGRFIPGDISAIILSWYVELKRPELPKRIVTAISTSHFLVEENLIKRGI
EVVWTRVGFLNIARKIIELGGALSGFEDNGGFAYVPHQLIRDGTMTAALMAEYLASIDTS
LASVVDSIKKPIVLREKLPIQSREEGKKIIEGIKEIYRGNRYIDIDGIKVISHNFAFLVR
PSGTEPLIRITVESWDRNIAEKTLNELITYIKSIQGKNQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggagagaaagctatttggaacggatggagttagatggatagtagataaggaa
agtctagatttcgtattaagattggcaatggctataggaagctattttccaaagggctct
agagcacttgttggtatggatggtaggcttggaaattcagcaatatatggaactgttcta
agtgccctctctgcttcagggtcgaaagtttatgatgcaggcttactacctactccagca
ttacaatactgtgtaaaagagtttggatttgactatggtgttatggtaacggcaagccat
aatccaccagaatgggtaggtataaaattgatattaagtgatggtatagaagctccacca
aatgttgatgtagaggtagaatcaatattatttgagtctaaattcaggagagttcaatgg
tatgaagtgagatcgatagaaaaatttgaaggtgctataggatattatattgatgcaata
aagaaacatgtagatgtagagaaaattaggaagaagcaaataaaagttgttgtagattgt
gctaatagtgtttcagcacttacaacacccagaactttaaaagagcttgggctaaaggta
ttgtctataaattccgatataggtattccatatagaccctatgaacctacacctgaaaac
ttatatgaattaatgagtattgtaaaggcagttggtgcagattttggtgttgcacatgat
ggtgatggtgatagagcagtatttattgataatctaggtagatttatccctggggatatt
tcagcaataatactttcatggtatgtcgaattaaagagaccagaacttccaaagcgaata
gtaactgctatttcaacaagtcacttccttgttgaggaaaatttgattaagagaggaatc
gaagttgtgtggacaagggtaggatttttaaacatagctagaaagataattgagcttgga
ggagctctctcaggttttgaggataatggaggttttgcatatgtaccccatcaactaatt
agagatgggactatgactgccgccttaatggcagaatatttagcctctatagatactagt
ttagcttctgttgtagactctataaagaaacctatagtattgagggagaagctaccaata
caaagtagagaggaaggtaagaagattatagaaggtattaaggagatatatagaggcaat
agatatatagatatagatgggataaaggtcatatcacacaattttgcatttcttgtaagg
ccaagtggaactgaacccttgataaggataactgtagagtcgtgggatagaaatatagca
gaaaaaacattaaatgaattaataacttacatcaaatctatccaaggtaaaaatcaatga

DBGET integrated database retrieval system