KEGG   Ignisphaera aggregans: Igag_1535Help
Entry
Igag_1535         CDS       T01307                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
iag  Ignisphaera aggregans
Pathway
iag00900  Terpenoid backbone biosynthesis
iag01110  Biosynthesis of secondary metabolites
iag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:iag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Igag_1535
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Igag_1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ADM28337
UniProt: E0SR07
Position
1425453..1426736
Genome map
AA seq 427 aa AA seqDB search
MEQEGIKTSRIQGFYKLSIDERLKIVKEIANLTDEEVNLLRNFGNLDPKIADSMIENVIG
AMSYPFAVAVNFKINGKDYLVPMVIEEPSVVAAASNAARMLREGEGIRALADKQYMIGQI
HILNPKSPYTAINEILLHKEEILEAANATNNTLRKLGGGAKDIEVRIVETRRGISIIVHL
IVDVLDAMGANTVNTMAEAVAPMIERITGGEARLKIVSNYAIYRLVRAWVRVSPDAIGGR
DVAEKIVDASALAEADPFRAVTHNKGIMNGIIAVALATAQDHRAIEAGAHAYAARSGTYK
PLSRWDIDSDGYLTGFLEIPLQVGIVGGAVKTHPIARIALKILNIKSAKELAEVMAAVGL
AQNFAALRALVTEGIQRGHMKLHARNLAILAGATGELVEIVAEQMIKEGKISFDYAKELV
EKYTSHG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagaaggtataaaaacatctagaatacaaggattctataagctctccatagat
gaacgattgaaaatagtcaaagaaatagcaaatttgacagatgaagaagttaatttattg
agaaattttgggaatcttgatccaaaaatagctgattctatgattgaaaatgttataggt
gcaatgtcttatccatttgctgttgcagttaactttaaaataaatggaaaggactatcta
gttccaatggttattgaggaacccagtgtagtagcagcagcaagtaatgctgctagaatg
ctacgtgaaggtgaaggtataagagcattagctgataaacagtatatgattggtcaaatc
catatactaaaccccaaatctccttatactgctataaatgagattctacttcataaggag
gagatacttgaagcagctaatgcaacaaataatactcttagaaaacttggtggtggtgct
aaagatattgaggttagaattgtagagactaggaggggtatatctatcattgttcattta
attgtcgacgttcttgatgcaatgggcgctaatacggtgaatactatggcagaagctgtc
gctccaatgatagagagaataactggtggagaagctaggctaaagatagtttcaaactat
gctatatacaggttagtaagagcatgggtaagggtttcaccagatgctataggcggaaga
gatgtagcggaaaaaatagttgatgcaagtgccttagcagaagcagatccatttagagct
gtaacacataacaaaggcattatgaatggtattatagcagttgcacttgcaacggcacag
gatcatagagcaattgaggcaggagcccacgcatatgccgctcgtagtggtacatataaa
cccttaagtagatgggatatagatagtgatggctatctcacagggtttttagaaatacca
ctacaggttggaatagttggaggagcagtaaagactcacccgatagctagaattgctctt
aaaatactaaatattaaatcagctaaagagttggcagaggttatggcagcagtaggttta
gctcagaattttgctgctctaagggctttagtaacagaaggtattcagcgaggccatatg
aagttgcatgctagaaatcttgctattttagcaggtgcaacaggagagctcgtagaaatt
gttgctgagcaaatgataaaggagggtaagataagctttgactatgcaaaggagttagta
gagaagtatactagccatggttaa

DBGET integrated database retrieval system