KEGG   Ignisphaera aggregans: Igag_1561
Entry
Igag_1561         CDS       T01307                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
iag  Ignisphaera aggregans
Pathway
iag00290  Valine, leucine and isoleucine biosynthesis
iag00770  Pantothenate and CoA biosynthesis
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01210  2-Oxocarboxylic acid metabolism
iag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Igag_1561
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Igag_1561
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Igag_1561
SSDB
Motif
Pfam: IlvN IlvC F420_oxidored 2-Hacid_dh_C NAD_binding_2 AdoHcyase_NAD ApbA Crp
Other DBs
NCBI-ProteinID: ADM28363
UniProt: E0SRA9
Structure
PDB: 
4XDZ 4XEH 5E4R

Position
complement(1446757..1447764)
AA seq 335 aa
MAKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDD
GFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPP
KDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVI
ESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIY
EKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMP
TVFKELSELEGSTIETVGRKLREMMFRGMKQISSH
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgaaaatatataaagatgaagatatatcgctagaacctataaaaaataagacgata
gcaatccttggatatggaagtcaggggagggcatgggcattaaatctaagggatagtggt
ctcaatgttgttgtaggtcttgaaagacagggagatagctggagaagggctatagatgat
ggctttaaacctatgtatacaaaggatgcagtagctattgcagatataatagtatttcta
gtgcctgatatggttcaaaagagtttatggcttaatagtgtaaaggactttatgaagaag
ggtgcagatttggtgtttgcacacggttttaatattcattttaagataatagagcctcct
aaagattctgatgtatatatgattgcacctaagtctcctggacctatagttaggagaagc
tatgagatgggcggtggtgttccagctcttgtagctgtttatcaaaatgtctctggagag
gctttgcaaaaagctttggctatagctaagggtattggatgtgcaagagcaggtgtaata
gaatctacatttaaggaggaaacagagacagatttatttggagaacaagtgatacttgtt
ggaggaataatggagctaataaaagcttcatttgaaacccttgttgaggaggggtaccag
cctgaagttgcatattttgagactgtaaacgagttgaagctaatcgttgatctaatttat
gaaaaaggccttacaggtatgcttagagcggtatcagacacagctaaatatggtggtatt
actgttgggaaattcattatagataagagtgttagggataaaatgaagattgtgttagag
cgtattagaagtggagaatttgctcgtgaatggattaaagaatatgagaggggtatgcca
acagtatttaaagaattaagtgaattggagggaagcaccatagagactgtaggaagaaaa
ttacgtgaaatgatgtttagaggaatgaaacagatttcttctcattag

DBGET integrated database retrieval system