KEGG   Ignavibacterium album: IALB_1071Help
Entry
IALB_1071         CDS       T01943                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ial  Ignavibacterium album
Pathway
ial00020  Citrate cycle (TCA cycle)
ial00640  Propanoate metabolism
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01120  Microbial metabolism in diverse environments
ial01130  Biosynthesis of antibiotics
ial01200  Carbon metabolism
Module
ial_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ial_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IALB_1071 (sucC)
   00640 Propanoate metabolism
    IALB_1071 (sucC)
   00660 C5-Branched dibasic acid metabolism
    IALB_1071 (sucC)
Enzymes [BR:ial01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     IALB_1071 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATPgrasp_Ter ATP-grasp_5 Succ_CoA_lig Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: AFH48782
UniProt: I0AIH5
Position
1205828..1207042
Genome map
AA seq 404 aa AA seqDB search
MKIHEYQAKEILKKYSVPVQDGIPVKNMAEFDKALAELQARGINQFVVKSQIHAGGRGKG
KIYDVRNRENLLLEGGVKFTTLPEKATEYAEKILGNILVTHQTGPEGKIVKTIFLAEGLD
YKKELYLGILLDRSVSKNVIMVSTEGGVEIEKVAEETPEKIIKEWIDPSVGLQNYQARKL
AFALGLQGEAFKSFIPFIKNLYRAYEETDASLLEINPLIITNDDRVVALDAKMNFDDNAL
FRHPEIYAYRDLDEEDPLEIEASKYNLNYIKLDGNVGCMVNGAGLAMATMDIIKLAGGEP
ANFLDVGGGANKETVANGFKIILSDPNVRAILINIFGGIVRCDRVAQGVIDAAKEMAVKV
PIVVRLEGTNAKEAADLLAASDLHFEVAKSLKEAAEKVTSVLRN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacacgaatatcaggcaaaagaaattcttaaaaagtattcagtacctgtgcag
gatggtattccggttaaaaatatggctgagtttgataaagctttggctgaacttcaggcg
agaggaataaatcaatttgttgttaaatcacaaattcatgcaggtggaagaggtaaaggt
aaaatttatgatgtaagaaatcgcgaaaacttattacttgaaggtggagttaaattcaca
actctgccagaaaaagcaactgaatatgctgaaaaaatattaggaaatattctggtcact
catcagactggtccggaaggcaaaattgttaaaacaatttttcttgctgaaggattagac
tacaaaaaagaactatatctcggaatacttctcgacagatcagtttcaaaaaatgttatt
atggtttcaacagaaggtggggttgagatagaaaaagttgcagaagaaactccggaaaaa
ataattaaagaatggattgatccttcagttggattacagaattatcaggcgcgcaaactt
gcatttgcacttggattacagggcgaagctttcaaaagcttcatccctttcattaaaaat
ctttatcgtgcttatgaagaaacagatgcatcgctgctggaaattaatcctttaataatt
acaaatgacgatcgtgtcgttgcacttgatgctaaaatgaattttgatgataatgcttta
ttccgtcatcctgaaatttatgcttatcgtgatcttgatgaagaagacccgcttgaaatt
gaagcttcaaagtataatcttaattacattaaacttgatggtaatgttggttgtatggta
aatggtgccggtcttgcaatggcaactatggatataataaaacttgccggcggtgaacct
gctaatttccttgatgttggtggtggtgccaataaggaaacagttgccaacggatttaaa
attattctctctgaccctaatgttagagcaatattgattaacatattcggtggaattgtt
cgttgtgacagagtagctcagggagtaattgatgctgcaaaagaaatggcagttaaagtt
ccgattgttgtaagacttgaaggaaccaatgctaaggaagccgctgatttattagccgct
tctgatttacattttgaagttgcaaaaagtcttaaagaagccgctgaaaaagtaacttca
gttttgaggaattaa

DBGET integrated database retrieval system