KEGG   Ignavibacterium album: IALB_2412Help
Entry
IALB_2412         CDS       T01943                                 

Definition
(GenBank) Glutamate decarboxylase-like protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ial  Ignavibacterium album
Pathway
ial00350  Tyrosine metabolism
ial00360  Phenylalanine metabolism
ial00380  Tryptophan metabolism
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ial00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    IALB_2412
   00360 Phenylalanine metabolism
    IALB_2412
   00380 Tryptophan metabolism
    IALB_2412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ial04147]
    IALB_2412
Enzymes [BR:ial01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     IALB_2412
    4.1.1.105  L-tryptophan decarboxylase
     IALB_2412
Exosome [BR:ial04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IALB_2412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_1_2 Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AFH50115
UniProt: I0AMA8
Position
complement(2742673..2744118)
Genome map
AA seq 481 aa AA seqDB search
MENNYTDMPVEEFRESGKKLIDWVADYLNEIEKYPPLSQVKPGEILKRIPENPPLKGEEI
QKILNDVDKILIDGITHWNHPGFMAYFNSTSSGPGILAELLSAAINANGMLWKTSPAFTE
LEKAMMNWFRQMVGLPENYWGIIYDTASTSSMHAIASAREQLNLNIREKGMSGRTDLPKL
RLYCSEHAHSSIEKGALTLGIGLDGVKKISVNEKYEMNSEELEEAIKSDISNNIKPFCVV
ATVGTTSTTSIDPVRKISEICNKYNLWLHIDAAYAGVTAMIPEMQRITDAWDEADSIVIN
PHKWMFTPMDLSIYFTRKPEILKRAFSLVPEYLKTQVDDEVENLMDYGIQLGRRFRSLKL
WFIIRYFGVEGLATRIKHHIELAKEFANWIDEEKDFERMAPVPFSTVCFRFNPGNKSDED
LNQMNEKLLEEINSSGKIFLSHTKLNGKFVIRLTIGSIRHERRHIVEAWGLIKSLAEKIV
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaattatacagatatgcctgttgaagaattccgtgaaagtgggaaaaaactt
attgattgggtagcagattacctgaatgaaattgaaaaatatccgccgctttcacaagtt
aaacccggagaaatcttaaaacgcattccagaaaatccaccgctaaaaggtgaggagatt
caaaaaatattaaacgatgttgataaaattttaattgacggaattacgcattggaatcat
ccaggttttatggcttatttcaattcgacttcgagtggaccaggaatattagctgagttg
ctatctgctgcgattaatgccaatggtatgttatggaaaacttcacctgcttttaccgaa
cttgaaaaagcgatgatgaattggttcagacaaatggttggacttccggaaaattattgg
ggaattatttatgatactgcttcaaccagttctatgcacgcaattgcttcagcaagagaa
cagcttaatctgaatataagagaaaaaggaatgtccggcagaactgatttacctaaatta
agattatactgttccgaacacgcacattcatcaatcgaaaaaggtgctctcacactggga
ataggtttggatggagtaaagaaaatttctgttaatgaaaaatatgaaatgaattctgaa
gagcttgaagaagcaattaaatccgacatctcaaataacatcaaaccattttgtgttgtt
gcaactgttggtacaacatcaactacaagtattgatcctgtaagaaaaatttcagaaata
tgtaataagtataatctctggctgcacattgatgcagcatatgccggagtaactgcgatg
attcctgagatgcaacggataaccgatgcctgggatgaagccgattcaatagttatcaat
ccgcataaatggatgtttactccaatggatttgagcatatattttacaagaaaacccgaa
atacttaaaagagctttcagcttagttcctgaatatttaaagactcaggttgatgatgaa
gttgagaatcttatggattatggaattcagcttggaagaagatttcgttcattaaaactt
tggttcattatcagatattttggagttgaaggattagcaacaagaataaaacatcatatt
gaattggcaaaagaatttgcaaactggatagatgaagaaaaagattttgaaagaatggca
cctgttcctttctcaactgtttgtttccgatttaatccgggaaataaatctgatgaagac
ttgaaccaaatgaatgaaaaattattggaagagattaattcttcaggaaagattttttta
tctcatacaaaacttaatggtaagtttgtcatccgattaacaataggaagcatcagacac
gaaagaagacatattgttgaagcctggggactaattaaatctttagcagagaagattgtg
ttatag

DBGET integrated database retrieval system